CAZyme Information: MGYG000003402_01472

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_01472
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		43207.08	6.5027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 13831; End: 14976 Strand: -

Full Sequence      

MAEATVVERMPVRIGDTILSACVDGYHPGIANKWGYVAGMALTALGRLGDWTGEQRYHEA
VKRHMDVFIRDDGSIAGYTLEEYNLDHINKGKNLLRLWRTTGEARYRQAAELLVSQLIGQ
PRTDEGGFWHKKIYPFQMWLDGLYMSSPFMAEYAAAFGEPDWFDEAARQLLLIERRTRNP
ETGLLHHAYDESREQRWCDKETGRSRHVWGRAMGWYAMALVDALEFFPVRHPQRGQLMGI
FERMANAIVRVQDQASGLWYQVMDCNGRQGNYLEASGSCMLTYALAKGIRLKYLAEIDRE
VVERAYEGIKKHFVTVDGEGVHLHGICHGAGLGGRKYRDGSYAYYISEQVVSDSLMGVAP
LLLASMEMERLQAEGEGGHPQ

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	370	2.7e-117	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.59e-114	31	371	31	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.44e-109	12	372	3	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04791	LanC_SerThrkinase	0.003	93	318	94	287	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY76571.1	5.09e-278	10	381	1	372
AYB47099.1	9.39e-258	1	379	1	379
ACX62421.1	1.43e-252	1	379	1	379
QNK59417.1	1.41e-209	9	374	12	379
QZN78892.1	1.26e-194	10	374	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.56e-119	30	371	19	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.11e-79	31	371	36	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.64e-79	31	371	26	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.62e-16	121	319	146	337	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.09e-79	31	371	36	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.17e-39	145	367	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.17e-39	145	367	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_01472.