CAZyme Information: MGYG000003402_01473

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_01473
• CAZy Family: PL22
• CAZyme Description: Oligogalacturonate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		43461.61	5.5208

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 15002; End: 16147 Strand: -

Full Sequence      

MAKGTVWKPERRQYRDRLTGVEVAQLTDYKAHSHHLYFTENGWYDGGRRLLFVSDRGNSA
NLYSMEVESGEMLQLTDYPDNDELDACLLPDGTAAFVRMGRSVRRLDLATLEEVELYEAP
QGYTIGNLSCPADGRSVVTCIQEDLSDRMQLDLGNGYVGHRELMQAQPHSRIIRLDAKGR
TQPETLHEEHNFITHINASPVEPWLMTFCHEGPWHEVDHRIWGLDLRSGEVWKIRERLEP
GEKVGHEFFYPDGVTIGYHGFRVDGTNFFGSIRYDNTAMEETEFGFHTWHAYADGLGQAV
VDGKGAVRTLSVWRKDAGGIYQGPSMLCELRCSFHSQKVHAHPRFDPEGKRLLFTSDKNG
YANLYLVDMPDQFDTLPPFSV

Enzyme Prediction     

No EC number prediction in MGYG000003402_01473.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL22	28	149	9.4e-27	0.45660377358490567
PL22	182	366	5.6e-17	0.9238578680203046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14583	Pectate_lyase22	8.54e-36	1	372	1	385	Oligogalacturonate lyase. This is a family of oligogalacturonate lyases, referred to more generally as pectate lyase family 22. These proteins fold into 7-bladed beta-propellers.
COG0823	TolB	7.32e-05	43	157	245	361	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
PRK04792	tolB	0.001	39	120	309	398	Tol-Pal system protein TolB.
pfam07676	PD40	0.002	343	365	14	36	WD40-like Beta Propeller Repeat. This family appears to be related to the pfam00400 repeat This This repeat corresponds to the RIVW repeat identified in cell surface proteins [Adindla et al. Comparative and Functional Genomics 2004; 5:2-16].
PRK04922	tolB	0.004	14	92	275	347	Tol-Pal system beta propeller repeat protein TolB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY73535.1	1.31e-289	1	381	1	381
ACX62420.1	1.07e-263	1	381	1	381
AYB47100.1	9.39e-258	1	381	1	381
QNK59416.1	6.53e-220	3	379	9	383
QGH32873.1	3.18e-163	1	379	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PE7_A	1.77e-29	1	372	1	385	Oligogalacturonatelyase in complex with manganese [Yersinia enterocolitica subsp. enterocolitica 8081]
3C5M_A	1.87e-28	2	376	2	389	Crystalstructure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_B Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_C Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P21258	4.44e-35	1	372	1	385	Oligogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=ogl PE=2 SV=2
Q59418	6.08e-34	1	372	1	385	Oligogalacturonide lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=ogl PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_01473.