CAZyme Information: MGYG000003402_01836

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_01836
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
195	MGYG000003402_634|CGC1	22604.04	9.2559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 963; End: 1550 Strand: -

Full Sequence      

MEQDGSGMKWLRKKRVLLLLFVSFVGLLFLSSNWMTLLYPIEYRDEIRKHADYYDVDPFL
VASIIRVETNFKPGKESKKGALGIMQLMPDTANWAMEMAKLPSVTLSSVKNEVDTNIQLG
TWYIQNLHQEMDGNPIAAIAAYNAGPGNVKNWIKKGMWDGTYENVKRIPVGETRHYVQRV
IYYYNQYTSVYNDRF

Enzyme Prediction     

No EC number prediction in MGYG000003402_01836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	58	189	2.3e-31	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.92e-71	40	185	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.39e-50	38	184	1	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	8.12e-36	58	185	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.15e-31	39	192	135	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	9.59e-29	47	163	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY74864.1	9.45e-136	8	195	1	188
AYB42753.1	2.58e-124	8	195	1	188
ACX67122.1	2.58e-124	8	195	1	188
QOT10724.1	2.58e-124	8	195	1	188
ANA78888.1	1.05e-123	8	195	1	188

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	6.86e-22	39	194	449	605	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5O1J_A	1.23e-21	36	181	413	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.23e-21	36	181	409	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O24_A	1.24e-21	36	181	423	563	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.24e-21	36	181	419	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	3.81e-21	39	194	476	632	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.81e-21	39	194	476	632	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	3.81e-21	39	183	476	621	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	6.84e-16	47	183	64	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	5.14e-14	39	189	1418	1546	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000014	0.000000	0.000000	0.000000	0.000004

TMHMM  Annotations     

start	end
16	38