CAZyme Information: MGYG000003402_02122

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_02122
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559		63940.24	5.0957

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 2566; End: 4245 Strand: +

Full Sequence      

MIRLFNTHQIRKIEELEGMWDFAPAAALGEPPEAFPYKLPVPGCWELHPQFGTYRGTGVY
RKRIKLTEKTHLRLVFKGISHTAQVYFDGLLVARHYNAYTAFDAVIPDVEPGEHELLVYS
DNAFSEASALHVPNDYYTYGGIIRPVVLEEIGDLYIENVMFTPHREQGSWQGQWKVIIRN
IGQVTKKADVQGRLAGSNLPLGSCVVGPGERGELIVTLPYPDVQEWSLEQPNLYELRAVL
TVDESDCDDWIDRIGFREITTCNGKLLLNGRELVLKGVNRHEDHALAGAAFPLQLMAKDL
ELIVDLGCNAVRTSHYPYDERFLDMCDERGIAVWEENHARGLSLEQMMNPNFAWQSEQVT
REMVEQHFNHPSILIWAVLNECASDTKEGRVHYEKQLTLIKELDSSRPRSFASHHRDREL
CFDLADIVSFNLYPGWYTDEDPGELADQARAWADALGGRGKPMILSEFGADGFYGFRSPN
REKGSEERQADILRSNLEAYIRRDYISGMFIWQFSDCRVTEGLGWLLSRSCTRNSKGLVD
EYRRPKLAYETVREVLREN

Enzyme Prediction     

No EC number prediction in MGYG000003402_02122.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	8	555	4.9e-94	0.613031914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	4.79e-74	1	554	1	590	beta-D-glucuronidase; Provisional
COG3250	LacZ	9.88e-66	11	549	10	588	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	1.16e-47	263	555	5	296	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	5.80e-37	16	408	55	484	beta-galactosidase.
PRK10340	ebgA	7.57e-31	11	516	39	547	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY75985.1	0.0	1	558	1	558
ANA82580.1	0.0	1	557	1	558
AVV58679.1	0.0	1	557	1	558
AWP27867.1	0.0	1	557	1	558
QLG40546.1	1.98e-306	1	555	1	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NCW_A	4.73e-175	1	557	1	553	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]
6U7I_A	3.62e-54	74	554	85	586	Faecalibacteriumprausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_B Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_C Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_D Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii]
4JKM_A	1.98e-53	66	554	82	590	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
4JKK_A	1.90e-52	11	546	13	578	CrystalStructure of Streptococcus agalactiae beta-glucuronidase in space group I222 [Streptococcus agalactiae 2603V/R],4JKL_A Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R],4JKL_B Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R]
5C70_A	5.19e-50	80	554	98	595	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P12265	3.89e-51	67	554	112	620	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2
Q4FAT7	2.59e-49	135	554	207	624	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1
P06760	3.39e-49	135	554	206	620	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
Q5R5N6	4.46e-48	67	554	112	624	Beta-glucuronidase OS=Pongo abelii OX=9601 GN=GUSB PE=2 SV=2
P08236	6.12e-48	135	554	207	624	Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_02122.