CAZyme Information: MGYG000003402_02460

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_02460
• CAZy Family: PL3
• CAZyme Description: Pectate lyase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	MGYG000003402_841|CGC1	23702.6	6.9026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 815; End: 1489 Strand: +

Full Sequence      

MMKKFLSMMLCAGLAISLYGVQPSTAEAATVVNETIRVEAGQTFDGKGQTYVANPDTLGD
GSQAENQKPIFRLEAGATLKNVVIGAPAADGVHCYGNCTITNVTWQDVGEDALTLKSSGT
VNISGGAAYKAYDKVFQMNAAGTINIQNFRADDIGKLVRQNGGTSYKVVMNVENCDISNV
KDAILRTDSSSSTGRIVNTRYSNVPTLFKGFASGNTTQSGNTPY

Enzyme Prediction     

EC	4.2.2.2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	30	201	4.2e-76	0.9826589595375722

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03211	Pectate_lyase	2.05e-80	25	215	6	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVV54671.1	9.43e-136	2	224	1	224
ANA81211.1	9.43e-136	2	224	1	224
AWP29315.1	9.43e-136	2	224	1	224
BAA87892.1	1.10e-134	2	224	1	224
CAI48000.1	4.13e-126	28	224	1	197

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	1.51e-127	28	224	1	197	CrystalStructure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	5.96e-63	31	209	9	185	Theliganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	6.15e-63	31	209	10	186	Thecrystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	6.42e-62	31	209	18	194	C.bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	6.42e-62	31	209	18	194	C.bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D3JTC1	2.12e-121	2	224	1	222	Pectate lyase A OS=Paenibacillus amylolyticus OX=1451 GN=pelA PE=1 SV=1
Q9X6Z2	1.43e-119	2	224	1	222	Pectate lyase A OS=Paenibacillus barcinonensis OX=198119 GN=pelA PE=1 SV=1
Q65EF5	2.43e-75	2	204	1	203	Pectate lyase C OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=pelC PE=3 SV=2
O34310	3.23e-73	2	204	1	203	Pectate lyase C OS=Bacillus subtilis (strain 168) OX=224308 GN=pelC PE=1 SV=1
A1D5E3	7.52e-29	20	207	24	203	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999071	0.000189	0.000174	0.000168	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_02460.