CAZyme Information: MGYG000003402_02772

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_02772
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000003402_933|CGC1	27867	5.3604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 4179; End: 4931 Strand: -

Full Sequence      

MFGADDLTVENMTIRNDAGRGELVGQALAAYVDGDRIRFRNCRLIGHQDTLFTGPLPDKP
LKRGSFGGPRDGLRKAAGRQWYDGCYIEGDVDFIFGSATAVFTDCEIFSRNRLTAENLPH
VERHPEINGWITAASTPESSPYGYVFIRCRLTGDAPEGSVYLGRPWRNHAKVAWIDCWMG
AHIRAEGWDNWDKPESEATVTYVEHGCRGPGADRQHRVSWSGTLTDEQADQYSLGRIFEG
EAPWIPCPGS

Enzyme Prediction     

No EC number prediction in MGYG000003402_02772.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	238	1.2e-71	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.34e-65	4	240	188	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	8.25e-53	5	232	102	290	pectinesterase
PLN02432	PLN02432	2.66e-46	4	229	93	277	putative pectinesterase
pfam01095	Pectinesterase	1.03e-43	11	241	93	298	Pectinesterase.
PLN02665	PLN02665	4.83e-43	2	248	141	364	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY76462.1	3.24e-183	1	246	87	332
ANY70879.1	2.76e-108	3	246	88	324
QKS57661.1	4.34e-105	2	246	122	363
QLG37813.1	1.49e-104	2	249	104	348
QOS81752.1	1.48e-102	2	249	104	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.61e-22	9	249	94	308	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.04e-21	1	238	118	358	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	2.96e-21	2	246	93	342	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	8.59e-21	4	217	98	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	8.59e-21	4	217	98	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.85e-42	5	245	102	305	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	1.49e-34	2	245	177	378	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9ZQA3	1.23e-33	4	245	175	385	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
Q9SIJ9	1.31e-33	4	248	133	336	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9ZQA4	1.33e-32	1	245	124	333	Putative pectinesterase 14 OS=Arabidopsis thaliana OX=3702 GN=PME14 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_02772.