CAZyme Information: MGYG000003402_03033

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_03033
• CAZy Family: CE14
• CAZyme Description: N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		26136.55	5.6351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 905; End: 1612 Strand: +

Full Sequence      

MSDKLDILIFGAHADDAEIGMAGTIAKHVAAGRSVGICDLTQAEMSSNGTVEIRRGEAEQ
AAEVLNLKVRTNLGLPDRGLFATPEHVERITAEIRKHAPSIVFAPYWEDRHPDHVAASRL
VEEAVFNAKLRRYLPELPPVKVDELYFYFINDIGRTDLIVDVTEQYGTKERALSCYRSQF
EKTDENAVSTPLTEGYIERVRARDSLLGARSLIPYAEGFASKSPYTVHLFGSKQA

Enzyme Prediction     

No EC number prediction in MGYG000003402_03033.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	8	113	8e-24	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04001	thiol_BshB1	2.40e-99	4	224	1	223	bacillithiol biosynthesis deacetylase BshB1. Members of this protein family are BshB1 (YpjG), an enzyme of bacillithiol biosynthesis; either BshB1 or BshB2 (YojG) must be present, and often both are present. Bacillithiol is a low-molecular-weight thiol, an analog of glutathione and mycothiol, and is found largely in the Firmicutes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
COG2120	LmbE	8.03e-43	1	221	7	225	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	1.51e-27	9	121	1	124	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY71799.1	6.86e-164	1	235	1	235
AYB45149.1	2.08e-149	1	235	1	235
ACX64513.1	4.01e-147	1	235	1	235
QOT13102.1	2.32e-146	1	235	1	235
AWP28366.1	2.22e-144	1	235	1	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXD_A	1.85e-80	5	228	4	226	Crystalstructure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus],2IXD_B Crystal structure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus]
6P2T_A	4.29e-67	6	222	25	242	BshBfrom Bacillus subtilis complexed with citrate [Bacillus subtilis subsp. subtilis str. 168],6ULL_A BshB from Bacillus subtilis complexed with a substrate analogue [Bacillus subtilis subsp. subtilis str. 168]
1UAN_A	5.04e-42	5	224	2	218	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q81ST8	4.78e-81	5	228	4	226	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus anthracis OX=1392 GN=bshB1 PE=1 SV=1
Q81FP2	7.81e-80	5	228	4	226	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=bshB1 PE=1 SV=1
P42981	5.07e-66	6	222	5	222	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=bshB1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_03033.