CAZyme Information: MGYG000003402_03085

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_03085
• CAZy Family: CBM56
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207		22479.34	7.3117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 19; End: 642 Strand: -

Full Sequence      

MMRKGLSYLLILSLLLTCCTFFGTKAEAADYTQGVERSGSTATIWFKSSVNTSWVDVHYK
VNDGVQQNLRMAYNAGKSRYEQAITGIAAGNVIAYWFTYNNGTPAYDTNIFTYTAGSTPD
PPSSGSIYDILPSSIPMPPNGAVSVKIMNGTHGAYTDQQIYWGVLGINPLNGRWSYLDLS
GNLIPISSALNDAPGHLTKNGIHYANI

Enzyme Prediction     

No EC number prediction in MGYG000003402_03085.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM56	23	119	3.1e-31	0.5974842767295597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09214	GH64-like	1.12e-16	143	207	1	63	glycosyl hydrolase 64 family. This family is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain, and in the Salinispora tropica CNB-440, coagulation factor 5/8 C-terminal domain (FA58C) protein, they are positioned C-terminal of two FA58C domains which are proposed to function as cell surface-attached, carbohydrate-binding domain. This FA58C-containing protein has an internal peptide deletion (of approx. 44 residues) in the LPHase domain II.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY76771.1	1.22e-143	2	207	1	206
ACX65717.1	1.65e-124	1	207	1	207
QOT12033.1	3.32e-124	1	207	1	207
QAV19347.1	3.22e-119	2	207	1	206
ANA82575.1	6.04e-107	2	207	1	207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H9X_A	3.69e-84	23	207	18	201	Crystalstructure of GH family 64 laminaripentaose-producing beta-1,3-glucanase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5H9Y_A	3.69e-84	23	207	18	201	Crystalstructure of GH family 64 laminaripentaose-producing beta-1,3-glucanase from Paenibacillus barengoltzii complexed with laminarihexaose. [Paenibacillus barengoltzii]
6A6C_A	3.53e-35	29	113	1	84	Crystalstructure of carbohydrate-binding module family 56 beta-1,3-glucan binding domain [Paenibacillus barengoltzii]
5T7A_A	1.26e-13	23	114	27	117	ChainA, BH0236 protein [Halalkalibacterium halodurans C-125],5T7A_B Chain B, BH0236 protein [Halalkalibacterium halodurans C-125]
5H4E_A	1.99e-12	140	199	6	65	Crystalstructure of a beta-1,3-glucanase domain (GH64) from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000643	0.610945	0.387598	0.000312	0.000270	0.000219

TMHMM  Annotations     

start	end
5	24