CAZyme Information: MGYG000003402_03121

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_03121
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42357.88	5.1251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 685; End: 1806 Strand: +

Full Sequence      

MSNQTQHKAPADITPLRLGIEACRSIMETFSPEELPPAGRWHYHQGVFLTGMFQLWKRCG
EAQYLEYIKGYVDHLVDTNGNVLLERGELDSVQAGLLLLELDAIKPERKYKAAADKLLRL
QSALNRTTEGGYWHKDRYPYQMWLDGLYMGGVFTMKYGQQYGQPHLYDEVLYQEQLMRKN
TLNEASGLYYHAWDESRHMPWADPATGQSPEYWGRSVGWYALSLVEFLDMLPEDHAGRAT
LVPVLRDLCNALVGCQDPATGLWYQVLDKGGEPDNWLETSCSSLFVYTLAKGVRLGHLDS
SFLEHARRGYQGLADAVYYNERGQLIMPDICIGTGVGDYRHYVQRDRCENDLHGVGALVM
ACVELDQSESPLG

Enzyme Prediction     

No EC number prediction in MGYG000003402_03121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	365	2.1e-106	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.47e-120	11	365	4	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.76e-111	22	364	5	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY75553.1	7.09e-274	1	370	1	370
AWP26962.1	4.07e-222	1	369	1	369
ANA83110.1	2.35e-221	1	369	1	369
AVV57800.1	2.35e-221	1	369	1	369
AYB43535.1	1.06e-217	1	368	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	3.28e-133	14	366	12	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.34e-132	14	366	2	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	5.92e-74	41	366	23	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	2.34e-21	126	341	147	356	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3K11_A	2.93e-18	43	364	82	409	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.80e-132	14	366	12	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.87e-34	149	364	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.87e-34	149	364	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_03121.