CAZyme Information: MGYG000003402_03980

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_03980
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		48689.3	5.1785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 21; End: 1310 Strand: +

Full Sequence      

MTEWLTVPAGSAVATNPQGMRYVRMYMSGNCGAPFQAEIRLEAAGVALNQVGQLQVDQPL
MRRIYDVSVHTSRVCHQIGLWDGIKRDRLNWAYDIYLAAKTEYSLWDDYSVLKRSLLELG
RTPYGYWMNNLPSYTLWWLSSIWDYYFETGDRAFVLEIREELLRHIAWVRENADAGTGVF
MPEAERTYSFIEWSPMAESESWACLNAIYSMTKSQMQQLARDIPELGIQWDEPRAELDES
RFIGSSYALLTSVIGIKSGYVGEEQARRFLLGYRLRDPLTPLSAYWLAECYSEYGMHERA
WEVIATVWGTMLDAGATTFWEGVRLTPSSDIHHALTTYTAYSSYRMSLCHSWSSTPVVWI
AKYVLGIRALSPGYERIAFEPHAVGGLTAASGVIPSPRGPIAVEWRLEEDGHMIKSARIG
GAELEGRLG

Enzyme Prediction     

No EC number prediction in MGYG000003402_03980.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	17	411	1.7e-67	0.8115079365079365

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17390	Bac_rhamnosid_C	3.15e-10	366	411	1	46	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17389	Bac_rhamnosid6H	0.003	50	364	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOT09079.1	2.41e-267	1	427	288	713
AYB46883.1	6.88e-267	1	427	288	713
ACX62648.1	2.27e-265	1	427	288	713
AYQ72908.1	5.98e-191	1	426	286	710
AZN39635.1	1.18e-151	1	411	284	694

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.13e-26	52	403	302	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	3.80e-12	38	365	193	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6I60_A	1.61e-07	286	410	766	880	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_03980.