CAZyme Information: MGYG000003403_00352

Basic Information

• Species: Stenotrophomonas maltophilia_AM
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AM
• CAZyme ID: MGYG000003403_00352
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
730	MGYG000003403_3|CGC1	78915.19	6.553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003403	4562306	MAG	United States	North America

• Gene Location: Start: 125724; End: 127916 Strand: -

Full Sequence      

MLKIICLTAALGAALGSTAQAADLQFDGRHARAEAAAKGSFVLHAPKGEVHIAPMPMRSQ
SGSVMFDALFALAQQEMDQDRVDAIRDPSFDEGRPVPCECFQTGARWPYVWTRDVSFAAD
LALARLDPQRTRQSLQFKLSAARDGHTPGLFVAQDTGSGGSWPISSDRVVWFLAARHLLE
DRAFSDQVWQALQGTLAQDRAMVFDEQMGLYRGETSFLDWREQTYPDWTREDVRFIGDSY
ALSTNVLHYQALRLAERLAGQRGDARVADYKAWADALARQIDARFWREDIGQYMSYIGEA
AHPVPYAKVDLLGLSLGVLAEVLPPERARRALAAYPMGPAGSPVVWPQEAQQPIYHNRAI
WPFVSAYSLRAARQLDDAPRIAAEIRSLMQGAALAGSNMENYELVSQAVHVEEGALSGPV
VNSERQLWSVAGYLSMVVEGVFGVQDDGRVQPKLPAVLVPELFGTHPRITLEANGKRYVL
ERPQNLGDGLLVAGRTTTRGATTTVQLVAAPAAAGFAATTADANARAPATPAAPQALRNG
AGWNVPVAAEQVLWMDGTVVAASNGQAHISDDGLQHCLSLTRRDNALESLHSPTVCVGPQ
QVLKGEDRWQFTSAKAGQVRLRLQYSNPNGPINTGVTAAVKQLVLQCPGQPLQQHTVTLP
HSVAVQDSTSATFAVPKGRCTVALEEGFNMSALQHFAHYTGGKGGRDGVLNQAQVQALTV
APVAMAEGAR

Enzyme Prediction     

No EC number prediction in MGYG000003403_00352.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	2.04e-07	111	431	31	370	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3459	COG3459	4.17e-04	112	334	614	853	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
COG3387	SGA1	0.005	107	299	282	474	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
TIGR01577	oligosac_amyl	0.005	85	293	277	464	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
pfam17389	Bac_rhamnosid6H	0.005	181	347	116	274	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBQ36601.1	7.17e-133	58	722	80	818
AVR98316.1	1.23e-128	58	722	77	815
AKF08192.1	6.24e-127	60	725	136	901
QCP11581.1	3.28e-120	58	728	77	842
AKT39344.1	9.65e-119	60	492	138	586

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000551	0.998501	0.000236	0.000240	0.000225	0.000202

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003403_00352.