CAZyme Information: MGYG000003403_00502

Basic Information

• Species: Stenotrophomonas maltophilia_AM
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AM
• CAZyme ID: MGYG000003403_00502
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744	MGYG000003403_5|CGC1	81971.09	6.191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003403	4562306	MAG	United States	North America

• Gene Location: Start: 22347; End: 24581 Strand: -

Full Sequence      

MSHDSLHPASLDDQAMVGAGLDERAAPALEDLVHARPADAFAWLGPHQQPDGQRQLRVLV
PHAHRVEVIAGPERRWGLQPGPLPGLFEGPAGEAPVPLLALHFEQGVEQVHDVYSFGPLL
DEALLQRFHAGDADAARQLGAVPTQVQGIAGVRFAVWAPNALRVAVVGDFNGWDGRRHPM
RLRHTAGVWELFLPGVQAGARYKFRIVGADGRVMPDKFDPMARWAELPPATASRVPSAVP
MQWHDDAWLAARRQAGTRAPLSIYEVHAGSWQRSDEGAPLDWDALAERLIPYVAGLGFTH
IELLPVSEHPFGGSWGYQPLGIYAPTARHGTPQAFARFVDRCHQAGVGVIVDWVSAHFPN
DAHGLAGFDGTALYEHADPREGVHADWDTLIYNYGRNEVAAYLIGSALEWVERFHIDGLR
VDAVASMLYRDYSRAEGEWIPNEQGGRENLQAVAFLRRMNQALRERFPDVLVIAEESTAW
PGVTAPVEEGGLGFTHKWNMGWMHDTLQYLGRDPVHRPHHHSEISFGLVYAFSERFVLPL
SHDEVVHGKGALLAKMAGEPAQRLAQLRAYYGFMWAHPGSKLLFMGGEFGQGHEWSHDAA
LDWAQAASGEGRGLSRLVGDLNAVLRAEPALYRDERDERGFAWSVADDNRNSVYAFIRRD
PAGSGRTLLVVSNFTPVQRDGYRVGVPQPGRWTERLNTDSGYYGGDNVGNLGAVLTEPSA
MHGHAQSLRLTLPPLSTLYLQVDA

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	291	591	6.8e-157	0.9966777408637874
CBM48	138	224	1.8e-20	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	111	741	1	626	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	115	741	1	620	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	149	735	637	1215	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	115	742	1	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	28	744	5	725	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPX92039.1	0.0	1	744	1	744
VEE51301.1	0.0	1	744	1	744
QGL93211.1	0.0	1	744	1	744
QGL97397.1	0.0	1	744	1	744
BCX44233.1	0.0	1	744	1	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LPC_A	2.06e-244	139	744	9	611	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
1M7X_A	2.45e-244	139	744	14	616	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
3K1D_A	1.17e-222	44	740	25	719	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
5GQW_A	7.12e-218	26	743	27	774	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	2.02e-217	26	743	27	774	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2P9F7	0.0	29	743	29	743	1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) OX=342109 GN=glgB1 PE=3 SV=1
Q4UZL7	0.0	18	743	4	728	1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=glgB2 PE=3 SV=1
Q3BYI0	0.0	16	743	17	742	1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=glgB2 PE=3 SV=1
Q5H6Q3	0.0	29	743	5	719	1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) OX=291331 GN=glgB2 PE=3 SV=2
Q8PDD1	0.0	18	743	4	728	1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=glgB2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003403_00502.