CAZyme Information: MGYG000003403_02431

Basic Information

• Species: Stenotrophomonas maltophilia_AM
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AM
• CAZyme ID: MGYG000003403_02431
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451	MGYG000003403_25|CGC3	49594.86	7.2741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003403	4562306	MAG	United States	North America

• Gene Location: Start: 199939; End: 201294 Strand: +

Full Sequence      

MFAWLRSQAWLRGAYHLLPTGLREGALRLFSRRLQARTRFVRTAAWEKTLQPAGDVVAGA
AGRGADLPGVNILGYIHGQFGLAEAARSYARALIEQGVPVALRDIDLGLPNARGDHALDA
YLDDTMPHAVSIIFVNPDYLAQALASIPLARGQGRYLIACWFWELERLPDSWLPALELVD
EVMVATGFVENAVAHATRKPVTRIPMPLGVLNDSGLQRVDFGLPQEAFVFLTSFDFSSRM
ERKNPEAVIRAFREAFPAQRRDVRLLVKSSNGHRFPHLLKHLLAIADGDERIIIRDEVIA
REHLNALQRCCDAYVSLHRAEGFGLGLAECMAMGKPVIATGWSGNMEFMDADSAGLVDFT
LVPVREGEYPAGKGQRWADAQVPMAAAWMRRLADDPGFAAALGQAGRTRVEAILSTQAAA
SGIIERVRQLQANARTAQDTMQTMKHEAGNE

Enzyme Prediction     

No EC number prediction in MGYG000003403_02431.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.08e-20	55	425	33	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd01635	Glycosyltransferase_GTB-type	4.86e-18	192	357	67	234	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0438	RfaB	2.15e-17	218	433	190	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03798	GT4_WlbH-like	1.57e-14	184	430	157	376	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
cd03808	GT4_CapM-like	3.47e-12	223	412	185	346	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO28913.1	9.38e-269	4	439	18	453
QGL66257.1	1.55e-267	4	434	18	448
ARQ88536.1	8.95e-267	4	439	18	453
QGL74570.1	6.57e-169	3	432	25	453
AZM72483.1	3.07e-167	3	433	19	448

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003403_02431.