CAZyme Information: MGYG000003403_02439

Basic Information

• Species: Stenotrophomonas maltophilia_AM
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AM
• CAZyme ID: MGYG000003403_02439
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		33784.66	9.5446

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003403	4562306	MAG	United States	North America

• Gene Location: Start: 210378; End: 211316 Strand: +

Full Sequence      

MRKVVVMPVYEDLEASSKLFLELARTQGPDTYVVAVDDGSVRQPLQVSAIEAAALEGVVI
KLRRNVGHQRAIAIGLSYVAEHFDDNVIVISMDSDGEDTPESITELVGGLSSPDVDVVVA
TRKSRVESLKFKSFYIVYKLLFSLLSGRKISFGNFMAAKMPAVRRLSSMQELWTHVAAAV
LGSKLRVQTCALDRGARYAGRSKMNFVGLALHGFRALMVFAEDVLVRVGIACTLVAGLSV
VGGVVALLLKTMGFATPGWFSLAFGILLLVFLQTAALTLIILMLSGMIRSGGVLVAGSYR
EFVDEVQHARRT

Enzyme Prediction     

No EC number prediction in MGYG000003403_02439.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04187	DPM1_like_bac	1.32e-17	5	171	1	167	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04179	DPM_DPG-synthase_like	8.55e-14	5	171	1	171	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
pfam00535	Glycos_transf_2	1.49e-09	5	122	2	115	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK10714	PRK10714	8.33e-07	1	133	5	137	undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional
COG0463	WcaA	1.11e-06	1	209	2	200	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASE53328.1	6.56e-189	1	311	1	311
QJC76342.1	7.16e-182	1	311	1	311
SQG65941.1	7.16e-182	1	311	1	311
QBL46351.1	7.16e-182	1	311	1	311
QEU33157.1	7.16e-182	1	311	1	311

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
225	247
262	284