CAZyme Information: MGYG000003405_00088

Basic Information

• Species: Leuconostoc citreum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc citreum
• CAZyme ID: MGYG000003405_00088
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000003405_3|CGC1	34477.6	9.8342

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003405	1610057	MAG	United States	North America

• Gene Location: Start: 10608; End: 11648 Strand: +

Full Sequence      

MKSSTIIKSAVAAGAFAAAGVATASANSVTVKSGDTLNQIARANGTTVDALVKANGINNP
NLIFVGQQLQTEGTASAAQAKPAQAPATATNGAYTVKAGDTLYRIAAANGTSVATLVAAN
NIQNLNFISVGQVLNLSGNAVAAAPAAKQVAAQPAVTPAQPATPAAKQVTQPEVAPATVA
PTQTVAPAQQTTTVTTQAAETTTATTQVTPVAQTTTPAVQPAQTATPATPNSAIQTLLNT
LNAKRSALGLGPVSLDAGLSARAAARAANAVANGGLPVNHFRTNGEVVAIGMGYGEVVNA
WYNETNMITNGTPGHRMWVANPRATSVGFGIVGDTIVAESDAGQYY

Enzyme Prediction     

No EC number prediction in MGYG000003405_00088.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	5.01e-13	28	70	2	44	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd00118	LysM	5.99e-13	94	136	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.10e-12	30	70	3	43	Lysin motif.
smart00257	LysM	5.94e-12	94	136	2	44	Lysin motif.
pfam01476	LysM	7.20e-12	94	136	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA56160.1	9.61e-178	1	345	1	346
QQE98361.1	3.43e-176	1	345	1	348
QOG09695.1	4.70e-176	1	345	1	347
QEA35961.1	4.70e-176	1	345	1	347
QGN61081.1	2.05e-175	1	345	1	349

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.999013	0.000177	0.000189	0.000182	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003405_00088.