CAZyme Information: MGYG000003405_00416

Basic Information

• Species: Leuconostoc citreum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc citreum
• CAZyme ID: MGYG000003405_00416
• CAZy Family: GT113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	MGYG000003405_6|CGC2	64785.06	7.5572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003405	1610057	MAG	United States	North America

• Gene Location: Start: 44225; End: 45904 Strand: -

Full Sequence      

MKIIITEKVNRELLEWQAGQKEKVHVVSWTAEVNYKPQHNESNLYQFMRKGYSEYLIKDL
PWIKQLVLNYRSIPGNHELEFKDAQNNVVIKVYLRKNTQFVEHVEVMDCFGNTLSNLIYS
GKNLAQQIDYDTSGHPVQNCLFGQHQKITTFWHAHDKKINNIGMSLVTKSKEVFYSRYWD
WHFEAFRKIIGTFENVSEIISYEAPTLNIDIPNKRVLFGELMSKTKRTKTKKWIVNFPKQ
NFWKPRNDVSKAAMAMGYTPIDFDTPYIDNEKWMTAQLEKHCLQINSGDTVVWQYPKYSP
QLELNMLNWFHNRGIKVASFIHDINLLREEPLNREHYLPEYDKILLSSFDANIVPEKFEQ
ALYSLANVKLKNIVALKPYDFIIQKPVLPATYSQDIVYAGSLAKFPALEDIDFNLTVYGE
KNFSDVNFVNPKIIDGGFLPAEELASSLNNGFGLIWDEDRQNPYRQAYTKWNWPYKFSLY
MVSGLPVIAWSESAIAKLIESENLGFIVTDLSQIASKVRSISQTEFNEMAANAAEIGNKL
AHGNSTKTALKKLENCQCP

Enzyme Prediction     

No EC number prediction in MGYG000003405_00416.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	241	554	1.7e-78	0.9658385093167702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	5.26e-62	244	555	19	331	sugar transferase.
COG0438	RfaB	8.73e-05	260	535	56	355	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA83270.1	0.0	1	559	1	559
ADG41120.1	1.09e-288	1	554	1	554
ARN64025.1	1.88e-182	1	554	1	563
QGM24585.1	6.10e-181	1	554	1	563
QEA58691.1	6.10e-181	1	554	1	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	6.70e-22	246	550	23	322	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	7.42e-22	246	550	31	330	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]
4W6Q_A	2.19e-18	246	550	23	322	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5A7L9	3.56e-21	246	550	21	320	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1
A0A0M3KKZ0	1.17e-17	246	550	21	320	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003405_00416.