CAZyme Information: MGYG000003405_00584

Basic Information

• Species: Leuconostoc citreum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc citreum
• CAZyme ID: MGYG000003405_00584
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000003405_7|CGC1	44541.66	5.0466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003405	1610057	MAG	United States	North America

• Gene Location: Start: 64573; End: 65724 Strand: +

Full Sequence      

MIKGVNLGGWLVLEKWMTPQLFSNVAAEDEYYLPRDLNPETYQARIDMHRANFITEADFL
RIASLGLDTVRIPVPYFIFGDVPPFQGAIDYLDKAFNWAEHYGLKILIDLHTVPGSQNGF
DNGGITGVQNWSQHPEKVAFTMSVLTRLAKRYAVRTGLYGIEVLNEPATQNMHNLMMKRY
KAREPELASENAPVTFEFLYQFYRQAYDQIRPILPSDKVIMFHDGFDISKWEGFFQHNTF
ENVVLDTHHYLMIAEIETEEITIPAYRRYMIKIGNEIEAVKQLVPIVVGEWSLFNSLATG
HSTNGGINPTQVKFEETAKQKDEDVLLINRELWNLQVEQWSRVDGYFFWSYKMNIDTVND
PDWYGWDAWSLERSVNKKWAIIK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	48	352	1.4e-131	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.41e-26	2	383	18	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	3.83e-04	53	167	24	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA34674.1	1.16e-215	1	382	1	382
AOT56404.1	1.16e-215	1	382	1	382
BAX70485.1	1.10e-213	1	382	1	382
API71899.1	1.10e-213	1	382	1	382
BAX72474.1	1.82e-212	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	3.76e-134	2	379	3	385	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	3.05e-133	2	379	3	385	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
2PF0_A	1.05e-40	1	363	14	373	ChainA, Hypothetical protein XOG1 [Candida albicans]
1EQP_A	1.80e-40	1	363	8	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	3.50e-40	1	363	8	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WK60	4.59e-54	1	371	41	396	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
B0XN12	4.59e-54	1	371	41	396	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
A1D4Q5	3.69e-52	1	371	41	396	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
A2RAR6	2.78e-51	1	371	41	396	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
A1CRV0	7.47e-51	1	371	41	395	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003405_00584.