logo
sublogo
You are browsing environment: HUMAN GUT
help

CAZyme Information: MGYG000003405_01509

You are here: Home > Sequence: MGYG000003405_01509

Basic Information | Genomic context | Full Sequence | Enzyme annotations |  CAZy signature domains |  CDD domains | CAZyme hits | PDB hits | Swiss-Prot hits | SignalP and Lipop annotations | TMHMM annotations

Basic Information help

Species Leuconostoc citreum
Lineage Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc citreum
CAZyme ID MGYG000003405_01509
CAZy Family GH70
CAZyme Description Glucosyltransferase-SI
CAZyme Property
Protein Length CGC Molecular Weight Isoelectric Point
1498 MGYG000003405_16|CGC2 167200.62 5.3065
Genome Property
Genome Assembly ID Genome Size Genome Type Country Continent
MGYG000003405 1610057 MAG United States North America
Gene Location Start: 20441;  End: 24937  Strand: +

Full Sequence      Download help

Enzyme Prediction      help

EC 2.4.1.5 2.4.1.- 2.4.1.140

CAZyme Signature Domains help

Family Start End Evalue family coverage
GH70 315 1112 0 0.9962640099626401

CDD Domains      download full data without filtering help

Cdd ID Domain E-Value qStart qEnd sStart sEnd Domain Description
pfam02324 Glyco_hydro_70 0.0 315 1115 1 804
Glycosyl hydrolase family 70. Members of this family belong to glycosyl hydrolase family 70 Glucosyltransferases or sucrose 6-glycosyl transferases (GTF-S) catalyze the transfer of D-glucopyramnosyl units from sucrose onto acceptor molecules, EC:2.4.1.5. This family roughly corresponds to the N-terminal catalytic domain of the enzyme. Members of this family also contain the Putative cell wall binding domain pfam01473, which corresponds with the C-terminal glucan-binding domain.
TIGR04035 glucan_65_rpt 3.49e-19 1380 1440 2 62
glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.
TIGR04035 glucan_65_rpt 4.77e-19 1315 1376 2 62
glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.
TIGR04035 glucan_65_rpt 2.54e-16 1444 1493 2 51
glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.
pfam19127 Choline_bind_3 2.16e-15 1323 1370 1 48
Choline-binding repeat. Pair of presumed choline-binding repeats often found adjacent to pfam01473.

CAZyme Hits      help

Hit ID E-Value Query Start Query End Hit Start Hit End
CCF26901.1 0.0 1 1498 1 1498
QEA36472.1 0.0 1 1498 1 1498
QEA55635.1 0.0 1 1498 1 1498
QOY97415.1 0.0 1 1498 1 1501
CCF27725.1 0.0 1 1498 1 1495

PDB Hits      download full data without filtering help

Hit ID E-Value Query Start Query End Hit Start Hit End Description
3AIB_A 2.20e-311 267 1102 4 842
CrystalStructure of Glucansucrase [Streptococcus mutans],3AIB_B Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_C Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_D Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_E Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_F Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_G Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_H Crystal Structure of Glucansucrase [Streptococcus mutans],3AIC_A Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_B Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_C Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_D Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_E Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_F Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_G Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_H Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_A Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_B Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_C Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_D Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_E Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_F Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_G Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_H Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans]
3KLK_A 1.69e-296 215 1154 3 948
Crystalstructure of Lactobacillus reuteri N-terminally truncated glucansucrase GTF180 in triclinic apo- form [Limosilactobacillus reuteri],4AYG_A Lactobacillus reuteri N-terminally truncated glucansucrase GTF180 in orthorhombic apo-form [Limosilactobacillus reuteri],4AYG_B Lactobacillus reuteri N-terminally truncated glucansucrase GTF180 in orthorhombic apo-form [Limosilactobacillus reuteri]
3HZ3_A 9.43e-296 215 1154 3 948
Lactobacillusreuteri N-terminally truncated glucansucrase GTF180(D1025N)-sucrose complex [Limosilactobacillus reuteri]
6SYQ_B 5.18e-291 229 1162 125 1135
ChainB, Alternansucrase [Leuconostoc mesenteroides]
6SYQ_A 8.56e-290 229 1162 214 1224
ChainA, Alternansucrase [Leuconostoc mesenteroides]

Swiss-Prot Hits      download full data without filtering help

Hit ID E-Value Query Start Query End Hit Start Hit End Description
P08987 0.0 206 1461 156 1374
Glucosyltransferase-I OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfB PE=3 SV=3
P11001 0.0 183 1453 142 1367
Glucosyltransferase-I OS=Streptococcus downei OX=1317 GN=gtfI PE=3 SV=1
P13470 0.0 206 1461 181 1402
Glucosyltransferase-SI OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfC PE=1 SV=2
P27470 0.0 183 1462 136 1371
Glucosyltransferase-I OS=Streptococcus downei OX=1317 PE=3 SV=1
P49331 0.0 182 1461 143 1404
Glucosyltransferase-S OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfD PE=3 SV=3

SignalP and Lipop Annotations help

This protein is predicted as SP

Other SP_Sec_SPI LIPO_Sec_SPII TAT_Tat_SPI TATLIP_Sec_SPII PILIN_Sec_SPIII
0.000428 0.998705 0.000303 0.000188 0.000180 0.000158

TMHMM  Annotations      download full data without filtering help

start end
12 34