CAZyme Information: MGYG000003406_00101

Basic Information

• Species: Veillonella sp009929605
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp009929605
• CAZyme ID: MGYG000003406_00101
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565	MGYG000003406_13|CGC1	64107.82	9.4496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003406	1742690	MAG	United States	North America

• Gene Location: Start: 19316; End: 21013 Strand: +

Full Sequence      

MKPQKKVPMRLTSPQNSSIPLPFLLGLITFLSYVFFNAHLPLTDPVETNYALTAKEMVLR
NDWLSPTIYGNYWYDKPIFTYWMIMVSFKLFGISDFAARLPGTLASTASVIAMYYSAQSL
FKSKTLGIYAAGILAFTLEFFYIGHAVVTDGFLLLFSIGIFALSYKGLTKENERAIIGAY
CCAALGVLTKGPVAIVLPGLIALIYIGMRWLLYRKSPLVPLKQLTSWKGILVFLIIASPW
YIAMYMTHGMNFINGFLGLQNVGRALISEHPKYNVWYFYLGITPILLLPWTPLIIYQTIK
NKWTDSTNQFGIIWFLVVFLFYSLVATKYITYTFIGIIPLILWAARGMENIVVVGSYKLK
LWLLWIPIDFLFLAAIIGSYYDDAIPSHRIIGAFIISHGIWFLMKVTKNKSIQILCTKLD
NIYNSRIDATIVKGFITVLVLFIGISISVSSVLYKSSGLPVAQYVSESNRPIYTYGIYYT
SLVYYTDKTPTFVTVPTHDDVRWTKGKNIMPNISEDELAKNLGTDHTPIMIVVPHKFYDE
FEISPLAKFVTDSEAIEFGYIMYVN

Enzyme Prediction     

No EC number prediction in MGYG000003406_00101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	22	499	2.1e-92	0.8833333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.53e-47	21	390	9	378	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	8.40e-21	45	361	31	347	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.68e-17	75	242	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	6.63e-05	50	245	35	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQB17357.1	2.55e-146	25	554	12	538
SNV00837.1	2.55e-146	25	554	12	538
ACZ25181.1	2.55e-146	25	554	12	538
CAB1276937.1	2.31e-144	25	554	12	538
BBU36964.1	6.59e-139	25	552	12	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.48e-13	42	328	54	344	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	7.29e-22	23	359	6	323	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
Q4K884	1.18e-21	40	340	53	356	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
A6V1N8	1.02e-20	45	348	30	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
O67270	1.43e-20	23	328	5	301	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q4KC80	1.82e-20	45	359	30	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43
78	100
126	148
191	213
226	248
275	297
310	327
332	354
361	380
385	404
431	453