CAZyme Information: MGYG000003406_01146

Basic Information

• Species: Veillonella sp009929605
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp009929605
• CAZyme ID: MGYG000003406_01146
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	MGYG000003406_189|CGC1	50070.42	9.7127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003406	1742690	MAG	United States	North America

• Gene Location: Start: 5; End: 1312 Strand: +

Full Sequence      

MLFRSDKPIFFYWELIGAYKLFGINEFASRLFPTIFSISSLGFLYWFTTKIADRRLAITA
VLVLGTSFAYWLLAKTVITDSTLFLFFNATLAFFYLAYSSNQKYYYYFCYIFAALSTLTK
GPIGFLLPGLIIVLFLASQRNFIEVHHMKLPLGLPLFLVIAGSWYGYMYALHGSAFLDTF
LGVHNVLRATASEHPKDNVWYYYTAIFFAITLPWGFTVPKQLYQQWKQRIPNWYKPPNYI
NYNPTTMFLLIWAITINVFFQCMATKYTTYTYPSLFPIAILMARYLVAHPNRVKVTAFIT
GITYIVLTYTLAIPLTNQFYSGKHTARYIESLSDTTAPIYFHGNYRASIPFYSGKTIIRV
VQDESLADTLPGGINWNAKNVMPITGFKEIDANKTAYLIESNPLKNNRPFDLDLITWSPV
MKTSNTTISTHIPTH

Enzyme Prediction     

No EC number prediction in MGYG000003406_01146.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	347	1.2e-71	0.5944444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.70e-30	2	295	59	345	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.37e-21	7	315	62	363	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.28e-15	6	165	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.94e-05	5	135	60	197	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO27725.1	3.13e-105	6	390	81	468
AVO74995.1	3.50e-104	6	390	81	468
CCC74317.1	3.50e-104	6	390	81	468
BBK25530.1	4.00e-104	3	410	60	457
BBU35875.1	1.26e-103	6	428	65	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.12e-12	6	281	87	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.18e-15	4	319	56	354	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8FRR0	5.48e-14	6	294	62	341	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
B4EUL1	5.25e-12	6	286	64	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
O67601	1.16e-09	3	206	55	244	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
Q2NRV9	6.20e-09	6	285	60	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
27	46
56	74
81	100
115	137
150	172
199	218
239	261
271	288
295	317