CAZyme Information: MGYG000003411_00019

Basic Information

• Species: CAG-568 sp000434395
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-288; CAG-568; CAG-568 sp000434395
• CAZyme ID: MGYG000003411_00019
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		45172.82	4.7377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003411	1362982	MAG	Fiji	Oceania

• Gene Location: Start: 23246; End: 24463 Strand: -

Full Sequence      

MIKRTKAISILLMLVSLASCEPIRFTFSKPSSNKSNTTNSSSSINTIDSIEITNPIDRLI
IGHTYQLNTSTDEEIIWESGNTNIVSIDEEGVITGKKIGSTTIYASLAIDSSVSTEMNIT
VVNKTPTPTSSSSSSNNNSSSSSQTDSVENENPNPKKYKLNWHDEFDGNSLNMNYWSYQE
GDGSQYGIPGWGNSEQQYYSQDNVSVNNGALKITARRENKGGKAYTSTRIRTANKVAFTY
GRIEAKIKLPPYQGLWPAFWMLPDTATYGNWPNSGEIDIMEAKGRLPNETSAAIHFADNN
NQHKYNTGTCDLNQTLSNNMKDWHTYAVEWESDSLFFYVDDICFFGSKCNQYSGVEGNSG
QPFDKNFHILLNLAVGGMFDNYINPNDSDLPASMEVDYVRWWGLK

Enzyme Prediction     

EC	3.2.1.39

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	162	402	1.8e-79	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.33e-94	162	402	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd08024	GH16_CCF	2.77e-42	162	402	3	329	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	5.10e-42	158	400	2	256	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd00413	Glyco_hydrolase_16	4.99e-35	164	402	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	1.29e-29	158	400	41	261	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMS84684.1	3.11e-69	158	400	123	369
ABJ15796.1	2.75e-65	157	404	536	793
QJC50501.1	1.95e-61	160	404	576	829
QGG54513.1	8.74e-61	160	404	516	769
AEE48598.1	1.04e-60	159	400	27	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VY0_A	3.23e-54	156	400	11	257	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]
4CRQ_A	2.36e-51	158	400	3	228	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	1.24e-50	156	400	2	229	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	9.53e-50	156	400	2	229	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
3ILN_A	5.41e-47	158	400	5	245	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	6.74e-53	160	400	425	677	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
P45798	5.86e-45	158	400	40	280	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	1.47e-44	160	402	22	267	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q27082	7.65e-41	157	400	24	250	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q9ZG90	1.25e-25	158	404	56	289	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000035	0.013625	0.986337	0.000008	0.000013	0.000008

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003411_00019.