CAZyme Information: MGYG000003411_00409

Basic Information

• Species: CAG-568 sp000434395
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-288; CAG-568; CAG-568 sp000434395
• CAZyme ID: MGYG000003411_00409
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823	MGYG000003411_7|CGC1	91605.45	7.3869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003411	1362982	MAG	Fiji	Oceania

• Gene Location: Start: 120204; End: 122675 Strand: +

Full Sequence      

MKHEDLIKKMTVEQKASMMSGKTVWETMDIPELGIPSIWLSDGPSGLRKQAGDSDQLGLN
ESLKATCFPSVAAVTNSWNPEISEKVGAAIGAEAKARRVSVLLGPGCNTKRNPLCGRNFE
YSSEDPYLAGKIDAGYIRGIQSNGIAACVKHFATNSQELKRESMDSVVDERTLRELYLTN
FEIAVKEGQALCIMSAYNSLNGYFANENKHLEMDILRDEWNFDGVVVTDWGGNNDRVEGL
KCMNSLEMPTTVGETNREIVKAIKDGKLDESILDQNVDYLLDLVFKTKTSYDKDQPVDFK
KDANIAKEAMDESVVLLRNEGNILPLNNDVKVAVIGDFAEHPRYQGAGSSIINPSEIVSG
LEAIKASGLNFIGYEEGFKRIGRKTKKGLVKKALALAAKSDVVLLYLGLDEFSEVEGMDR
TTYAIPQNQIDLIKALRATGKKIVTILSCGCAVELGAIRDNSDAIVYGSLCGQSGAKSIV
DIITGKVNPSGKLSESFPCQYKDVPSFNYYPGKDVTSEYREGLFVGYRYYLTRNIKVCYP
FGFGLSYTKFEYSDIKVDENGVTFKVKNVGDREGKEVSQLYIGLPNSGIVRPVRELKGFV
KTNLLPGEEKEVFIPFDDKSFRYFNTKTNKWEVETGDYEISIGSSSVDMQLTTSFHVEGT
NAPLPYTQEELPHYFTGDVTNVPDAEFEKLLGRPIPPHTFTWLNKKKTRIEITSNTTMSD
LRYAKGWTGRFFAHVISGLTKMFRKFGNEKMADTLIMGVSNQTVKVLSRMTNGAISWNQL
QGLLMMFNGHFHKGLHQYFKAGREKKKLNKQLKKEAEAKKANA

Enzyme Prediction     

No EC number prediction in MGYG000003411_00409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	236	1.4e-61	0.8981481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.55e-83	66	655	118	762	beta-glucosidase BglX.
COG1472	BglX	5.31e-60	25	340	50	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	7.45e-54	314	527	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	3.73e-53	6	617	56	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.85e-30	33	283	64	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK48658.1	2.41e-314	1	810	1	804
VEU80235.1	3.10e-313	1	807	1	804
AST98591.1	6.20e-308	1	813	1	804
QNM45585.1	6.20e-308	1	813	1	804
ANY69910.1	1.49e-307	1	810	1	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.28e-202	6	660	8	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.71e-170	10	665	12	671	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.28e-143	2	657	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.96e-142	2	657	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	6.05e-102	4	658	7	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.79e-201	6	660	8	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	8.60e-166	7	668	9	683	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.21e-165	7	668	9	683	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	4.46e-137	4	655	47	743	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	4.42e-114	4	657	3	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003411_00409.