CAZyme Information: MGYG000003411_00411

Basic Information

• Species: CAG-568 sp000434395
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-288; CAG-568; CAG-568 sp000434395
• CAZyme ID: MGYG000003411_00411
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
981	MGYG000003411_7|CGC1	109603.1	4.6254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003411	1362982	MAG	Fiji	Oceania

• Gene Location: Start: 124596; End: 127541 Strand: +

Full Sequence      

MKKTYQLTLLSLVTLSLGLASCNGAVPIEGKRNEAASSTPKSTATETEPSDLNIYLAYDG
ERTDRNYVWGWSDDPSLPGSLFPVSSADNVTFERTGDDIPFIPVYLTFGQEYECFNTWTD
DVTGTPSSSFTLTEDNVFTGLVFRDASGDKKDKKGDLIIDPSKIQVDENGHRSIWIDDSK
GVYYSINDFPVTPVESAIYKEVNNSDGTTSYTIELNAKTNKNLLETLPDASAIKSKRLTL
RIFRNNGAERKYKSSIYFKNDECVFTSDKITLVLNIDKPLDLSYKYVISLCYNPLDLMSD
LSEVDFKPYYSSRNFDMKYYTMEKLGATIQNGNTIFKVWSPSAADIKLNLYKDATTKQLT
QYTMKKDEKGVFSVGLVGNLHGYYYTFDVNNYGDVTKDVADPYAYSSNANGKRSMVVDFD
KIHEGDEEFASETTNKWAPSTDNYAGVTIMEMHTRDFSSSTSWNGTAANRGKFNALHESG
TSLSDGTKTGFDYVKELKDNGLTHVQIMPAFDFSSVDETKLNDSDYINKSYAGIYNWGYD
PQQYNAPEGSYSSDPNNGLTRVNEFSSFVEDYNKAGLGVVMDVVYNHMPSSNGTSFEDVF
PGYYFRSKNSSGAGADIASQRGMVRRFIVDSVVSWAKNYHISGFRFDLMGLLDMNTMVEI
RKALDKVDPNILVYGEGWSMFGGDPDYGYRHYDMGTQGNINAEGDNWVGAFNDDYRDALP
GKNDDTSVRGYIQQALGYADGEAINQTKLEKIYYGLTGTYWTGSTGRPTYSSKSADGIGA
SIAYVECHDNLTLYDHFELSRTSSMTENDIHKEVIMANDNLLGSLSSAFFQIGQDFGKSK
KVTDKDLLVPNTYYKDPFTNGVNYSHNSYNSSDKVNQIDWNLLKNNKDISTAFRKALKNR
STNAIELGSSYSCLDFYNTETGGNFKAELIDNDHVISYSLDIHDGEKVKTYYFAQNFTNE
AISFTQAGTTIPAYGTVSLVK

Enzyme Prediction     

EC	3.2.1.41	3.2.1.-	3.2.1.68	3.2.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	492	834	6.5e-81	0.9896193771626297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02104	pulA_typeI	8.62e-163	315	889	2	515	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
cd11341	AmyAc_Pullulanase_LD-like	1.17e-160	449	900	5	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	1.54e-95	318	965	60	654	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
TIGR02103	pullul_strch	9.60e-86	325	886	128	734	alpha-1,6-glucosidases, pullulanase-type. Members of this protein family include secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants. Both enzymes hydrolyze alpha-1,6 glycosidic linkages. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family is closely homologous to, but architecturally different from, the Gram-positive pullulanases of Gram-positive bacteria (TIGR02102). [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PLN02877	PLN02877	4.40e-78	325	886	215	803	alpha-amylase/limit dextrinase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEU82346.1	3.80e-115	54	904	31	792
QWB95757.1	1.17e-107	47	895	25	796
QLY39684.1	4.15e-106	273	880	233	810
APD05782.1	2.71e-102	316	943	49	620
ABX42665.1	4.58e-102	271	947	303	923

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WDH_A	3.32e-86	316	881	102	595	Crystalstructure of Pullulanase from Anoxybacillus sp. LM18-11 [Anoxybacillus sp. LM18-11],3WDI_A Crystal structure of Pullulanase complexed with maltotriose from Anoxybacillus sp. LM18-11 [Anoxybacillus sp. LM18-11],3WDJ_A Crystal structure of Pullulanase complexed with maltotetraose from Anoxybacillus sp. LM18-11 [Anoxybacillus sp. LM18-11]
7LSA_A	1.26e-82	311	961	49	667	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	1.62e-81	311	961	49	667	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	1.69e-81	311	961	49	667	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	1.72e-81	311	961	49	667	ChainA, Pullulanase [Ruminococcus bromii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33840	1.74e-78	319	850	219	717	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	3.82e-77	315	880	96	593	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
A0A0H2UNG0	2.71e-53	324	946	450	1074	Pullulanase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=spuA PE=1 SV=1
A0A0H2ZL64	4.62e-53	324	946	435	1059	Pullulanase A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=spuA PE=3 SV=1
Q9F930	1.98e-52	324	946	457	1081	Pullulanase A OS=Streptococcus pneumoniae OX=1313 GN=spuA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003411_00411.