CAZyme Information: MGYG000003412_00373

Basic Information

• Species: HGM12789 sp900766585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; HGM12789; HGM12789 sp900766585
• CAZyme ID: MGYG000003412_00373
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
894	MGYG000003412_13|CGC1	103762.73	8.0384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003412	2381083	MAG	Fiji	Oceania

• Gene Location: Start: 23233; End: 25917 Strand: -

Full Sequence      

MENAFQVTVITAVYKVEPFLREAIDSVIAQDIGFAEHVQLILVDDGSPDGCGAICDEYAA
RYPHNIEVIHKENGGVSSARNAGLSQAKGRFVNFMDSDDKLSPETLREVCAFFDRHLAET
DIVSIPLVFFDGKQGTHTLNFKFNRGDRVIDLDKEWTVPQLHVASSFIKRECVQRYPFDP
HLAYGEDALVVQKVLSDKCTLGVVSTATYFYRQRSGGEQSAIQLSGMRPNWYLPCTEHFH
LEIIRFYTEKYGYLPRFIQFTLMYDMQWRILQTDLPTGILPEEDCRKYRTELLEILQKID
DEAVLLQRNIGLAHKLFALKLKYGRAPDIVERPENTVFCYNGKAVAKMSDFSCRIDFLKM
EKGACAIEGCMAVYPSVFSKVTLEAILDGKAYPCREVTGRKGQVSLGEHIVENIGFAVEL
PLARESRTHELTFCVIADGRRIMVKNYFFPAFAPIGNEYEKAYFANDGWIVSREKTGFRF
EVETRKARKQKERAFLRNLWKRNLAGGRKAVLVRRLLPILRFFHRRPLWLISDRAAKAGD
NGEAFFRYMRKNHREIDARFVINADCADYAAMKAVGPVLKRGTLKQKLYLLLSEYVISSQ
AEIEIYNPFRGHFPPYRDILAKGRFIFLQHGVTENDVSDWLGKYQKNLYGFVTVARPEAE
SILHGNYHYTDRQVWLTGFPRFDRLYRVEEKRVTIMPTWRKYLMAGWNYQTDKWSLAPGF
AESRYLQFYNALLTDRRLLDAADRLGYQIDFLLHPTLLPHSAFFRADKRVHMLSPGEAYR
DIYARSQLVVTDYSSAVFDFAYLRKPVLYAQFDLDEFYRGAHVCAKGYFEFERDGFGEVT
YDLDTTVDRIIDYMENDCRLKDVYRERIDRFFAFDDQNNCARVYDRIRELEGKR

Enzyme Prediction     

No EC number prediction in MGYG000003412_00373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	8	152	2.7e-30	0.8470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	5.95e-44	522	887	1	358	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.41e-35	511	891	10	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
pfam00535	Glycos_transf_2	1.34e-27	8	171	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK10073	PRK10073	3.69e-27	1	109	2	109	putative glycosyl transferase; Provisional
cd00761	Glyco_tranf_GTA_type	7.77e-26	9	130	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASZ63009.1	3.19e-192	2	890	3	884
QAW34904.1	4.49e-192	2	890	3	884
AUS11687.1	6.34e-192	2	890	3	884
QAT47574.1	6.34e-192	2	890	3	884
ASB62640.1	8.94e-192	2	890	3	884

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	9.70e-21	6	99	6	95	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5HEA_A	6.36e-18	1	99	1	95	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
5TZE_C	2.36e-15	8	218	4	209	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	6.62e-15	8	218	4	209	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P46918	1.64e-174	5	894	8	897	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1
P46917	2.05e-40	8	321	3	318	Minor teichoic acid biosynthesis protein GgaA OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaA PE=3 SV=1
P71059	2.67e-18	7	102	5	96	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
A0A0H2URH7	2.18e-15	6	99	6	95	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
A0A0H3JVA1	3.63e-14	8	218	5	210	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain MW2) OX=196620 GN=tarS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003412_00373.