CAZyme Information: MGYG000003412_01466

Basic Information

• Species: HGM12789 sp900766585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; HGM12789; HGM12789 sp900766585
• CAZyme ID: MGYG000003412_01466
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759	MGYG000003412_38|CGC2	84679.82	5.1425

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003412	2381083	MAG	Fiji	Oceania

• Gene Location: Start: 115237; End: 117516 Strand: +

Full Sequence      

MIFPEQYIRATEEYTTFEHFVPAPYLRRSFMAKQSGRASLLICGLGFYELYLNGRRITKG
RLAPYISNPDDIVYFDRYEVELTEGENVIGVWLGNGFTNNPGGYIWDFDKARFRAAPQMA
LRLEYADAGEVCVLESDTQWRTAPSPITFDDYRFGEHYDARLEQPGWCAPGFDDSGWQPV
RLAPPPRGERRLCEAEPIDVVQEIAPVSVTKAGDGFLYDFGVNTAGVCRLKLKGTAGQCV
TLAHGERLVDGVPDMMNIWFPREHWARDLPLVHKDIYTAKGDGEETYVPTFTYHGFRYVL
VTGITAEQATPELLTLLEMHSLLEERGGFSCSDETANKLQEMTRRSDLSNFYYFPTDCPQ
REKNGWTADASLSSEHVLLNLAPENSYREWLRNIVKAQTDLGALPGIVPTGGWGLDWGCG
PAWDSVLIELPYQLYRYRGDKAVLKECAASILRYLHYLTTRTDENGLLAIGLGDWCPAGR
GTGDPVAPLEFTDTVVAKSLADKAAFIFDAIGMTEQAAFARALSVRFRAAVRARLIDPDT
LIAAGHCQTTQAMALYYGIFEPGERQAAFDRLLAMIEDRQGHIDVGVLGARVLFHVLTAF
GRSDLAFTMIVRPDYPSYGNWIECGATTLWEEHQPKGAFGNSQNHHFWGDISSWFIQALA
GIRLDPHHIGKMEVEIRPSFIPQLTHAEGFHIAPAGKISSAWQREDDGGITLTVELPEGL
PGCIQLENGFTFDDGRPSCPAKSGTYRIRAAKQKAGKTL

Enzyme Prediction     

No EC number prediction in MGYG000003412_01466.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	212	723	1.4e-124	0.9821428571428571
CBM67	21	183	1.4e-30	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.80e-75	324	659	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.04e-47	33	202	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.35e-21	210	320	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	9.78e-06	673	719	11	56	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	1.04e-159	15	705	135	820
AYB33152.1	3.35e-145	16	717	177	867
QNN24933.1	7.81e-145	22	704	351	1033
AHF16194.1	1.36e-142	16	755	165	887
QGA24212.1	2.68e-142	18	726	151	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.62e-96	23	730	176	902	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.15e-90	33	748	314	1028	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	9.90e-66	38	726	147	846	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.22e-90	33	748	314	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	2.79e-87	23	717	184	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.76e-70	25	717	172	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	2.67e-58	25	753	176	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003412_01466.