CAZyme Information: MGYG000003417_00391

Basic Information

• Species: Firm-11 sp004556545
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp004556545
• CAZyme ID: MGYG000003417_00391
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		38426.8	7.9539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003417	3316884	MAG	Fiji	Oceania

• Gene Location: Start: 3003; End: 4076 Strand: -

Full Sequence      

MAKRIVLTGGGTAGHVTPHLSLIPRLKEAGYEIHYIGTENGIEHQMIAAIPGIAYHSVKS
GKLRRYFSLQNFSDPFKVVAGAAESVALMRKIKPDVVFAKGGFVSVPVVVGAWMCHVPTV
CHESDLTPGLANRICAKFAWRVAATFPECAKALGEKGVMTGTPLRPELFRGSRAAGLALA
GFDGRKPVLLMTGGSLGAQSVNACLRKALPELLPHMDVLHLCGKGNLDESLKDLPGYCQK
EFLSAEMPDALAVADIVLSRAGSNTLSELLALHKPMLLVPYPLGASRGDQIENAKSYQRQ
GLAHVLMQEDMTPETMTKALLELLSQRQELVKTLEAYPVKDGTDAVLELIEEAQKQA

Enzyme Prediction     

No EC number prediction in MGYG000003417_00391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	189	334	1.8e-40	0.9171974522292994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	5.30e-141	3	353	2	352	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	6.59e-135	3	353	2	354	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	5.62e-114	4	352	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	7.14e-107	3	357	1	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	6.25e-89	3	350	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC66253.1	5.87e-172	3	355	2	354
QTE70149.1	1.18e-171	3	355	2	354
QTE74121.1	4.80e-171	3	355	2	354
QTE69037.1	1.51e-167	3	354	2	353
QUA52094.1	1.56e-167	3	356	2	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	2.11e-39	1	330	1	328	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	4.38e-35	3	351	10	363	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	5.96e-33	3	320	7	319	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97GY4	1.66e-130	4	355	5	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=murG PE=3 SV=1
A5MZ55	1.36e-125	3	351	2	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) OX=431943 GN=murG PE=3 SV=1
Q730T5	7.53e-125	3	353	2	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=murG2 PE=3 SV=1
A0Q182	1.26e-124	4	355	5	357	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium novyi (strain NT) OX=386415 GN=murG PE=3 SV=1
C4Z1B5	6.54e-124	3	355	2	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003417_00391.