CAZyme Information: MGYG000003417_01970

Basic Information

• Species: Firm-11 sp004556545
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp004556545
• CAZyme ID: MGYG000003417_01970
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600	MGYG000003417_177|CGC1	68819.36	5.1253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003417	3316884	MAG	Fiji	Oceania

• Gene Location: Start: 6760; End: 8562 Strand: +

Full Sequence      

MRLQNMNYRNVELTPGLCHSQLQEVIDYLLTLDEDRLLHQFRKGAGLPAPGETYYGWYGQ
GATTLGQWIGALAKLYSVTGDKRLQAKMRRLLDGWAECILPDGYVNFSNENKSTYGFEKY
VGGLVDAYEYGGYERAMDLLETITHWADQRFDKHITRDYATYAYLAARGMHEWYTLGENY
YRAYRLSERPLFLRFAEEWDYTHFWKDMAQKNDKLPPLHAYSHVNSLCGAAMRYEVTNDS
ESLAAIKNGYDLLTDKHLFATGGYGPSEALFGKPGYMGSSLLSQESRDLRSDCSFTNLSG
FCTCDDVLGSCEVSCCAWAVFKLTDYLLRLTGEARYAEWAEQFLINGTLAQLPLEKTGRV
QYYTNYFRHGGRKDLEDRRMGADSSANLWQCCTGTFPQDVAAYHELIYFQSEDALHVAQY
IPSRGSFDLKGQKVALQITGDFPMAQQYIVTVSPEQDTEFCLRLRVPSWAKDAAAFINDE
ECSSMPVSGQWLSIRRLWKKGDSVLLRFPYHLHWNPIDDEHPQMMALCWGPIVLAADEIA
ALRGDAEHPEEWIQPVDSETGLFETEPGHDAAFATRTHRYRPFYAVDDKHWYYMYTEVMP

Enzyme Prediction     

No EC number prediction in MGYG000003417_01970.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	11	535	6.3e-111	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.78e-82	10	535	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.26e-55	7	587	8	574	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ28339.1	2.03e-172	3	600	28	624
AIQ57120.1	1.19e-171	3	600	28	625
QOL32375.1	9.37e-134	1	598	11	600
QPM68145.1	1.82e-124	7	596	19	590
ARN56167.1	4.68e-94	7	597	57	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.75e-22	23	535	45	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	3.01e-21	314	539	334	564	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	9.32e-21	314	539	334	564	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5OPJ_A	6.37e-20	23	535	45	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.40e-13	219	537	247	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003417_01970.