CAZyme Information: MGYG000003417_02416

Basic Information

• Species: Firm-11 sp004556545
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp004556545
• CAZyme ID: MGYG000003417_02416
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	MGYG000003417_226|CGC1	82677.09	5.6594

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003417	3316884	MAG	Fiji	Oceania

• Gene Location: Start: 11330; End: 13591 Strand: +

Full Sequence      

MLPFQDTKLSPKERAHDLCARLTSREKTGQLNQRLYGFQSVRREGERLTLDEAFQKEVLR
FGGLGTLYGLYRADPWSGRNRENGLYGQNAVRAYNLAQRFVVEHSRFGIPMLVSSECPHG
HQALDGYLLPVNLAAGATFQPELLYEAGKVCGRQLRELGVDLALVSTLDILRDPRWGRSE
ECYGEDPFHASCFARAIVRGIQSQGVAVVAKHFCAQGETTGGLNASAARIGPRELREIHL
PAAKAVCQAGVRGIMAAYNEIDGVPCHANETLLREILRGEFGFDGLIMADGCAIDRLNDQ
TGDTMASGALALRSGVEISLWDEGFSRLDEALERGLMDEETLNRAVERVLALKFERGLFE
RPYLPEERPLTFFSKEAFPQSLALSRESIVLLKNEGVLPLRTGTLALIGPAADDLYRQLG
DYTPPVEPEAACTLLQGLRETSGPERPLCYDNGSDPERAAALAAKADTVVLALGGSSSRF
EQARFDTNGAALSGSMDCGEGVDSAGLRLPDGQHELFARVRAAAKKLVTVLIIGRPYAVP
EIAEGSDGLLVAFYPGPWGGQALAEILLGRFSPSGRLPVSFPRHPGQLPVYYNPKAGIVP
WSYADSKQGPLFSFGDGMGYGRIQYRDFELLPKPLPERTFSKETLSERKLPVDDMPVLEL
RFRAENPGPAEETAVPMLFVTDLEADVTRRVRELKAFDKKAVPAGGSAAFSLTLTAEGLA
VWNRRMERELQRGRFRLCLQDGGRSLYETIWTL

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	103	320	5.8e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.88e-106	3	737	23	748	beta-glucosidase BglX.
COG1472	BglX	2.68e-77	92	423	43	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.12e-60	23	352	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.62e-48	168	741	158	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.30e-44	389	620	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ61803.1	2.37e-275	4	748	5	778
CBL14322.1	1.05e-265	12	748	6	730
VCV20391.1	2.12e-265	12	748	6	730
QQO08493.1	4.50e-261	1	742	1	736
BCJ95064.1	2.20e-260	12	748	12	777

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	1.55e-90	4	753	36	784	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5Z9S_A	1.95e-83	2	753	15	787	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5XXL_A	3.56e-81	79	753	54	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	1.08e-80	18	737	10	716	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXN_A	1.83e-80	79	753	54	751	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	5.65e-79	4	735	24	746	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.06e-77	101	735	96	746	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.22e-76	4	735	29	736	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
T2KMH0	7.44e-70	104	735	60	702	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P14002	2.54e-55	106	746	34	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999879	0.000110	0.000012	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003417_02416.