CAZyme Information: MGYG000003419_00543

Basic Information

• Species: RF16 sp900766775
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900766775
• CAZyme ID: MGYG000003419_00543
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000003419_77|CGC1	36712.98	10.0712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003419	2335712	MAG	Fiji	Oceania

• Gene Location: Start: 9973; End: 10950 Strand: +

Full Sequence      

MTKLLIIRFSALGDVAMLVPVVERLANTYPRLYITILSRQQTAPLFADLPDNVHFYGADL
KGRHKGIKGMNRLLRDIDYQQFDAVADMHDVLRSKYLRMRFRLIGKRISVIQKGRLDKYL
LTKRHHISLPLPTTIERYQDVLQRLGLSVQLHPQRTNGGERVGIGIAPFAAHKGKIYPLK
KMEEVVRLLSKVGEPIYLFGAGKQEQTILEQWAETYPNVTSLAGKQDMAKEIAIMRGLQL
MVTMDSANMHLASIAGTRVLSIWGATHPAAGFLGYGQSENDCIQRDLPCRPCSVYGNKPC
QYSDYHCLNIAPKDIVNRIKQALCK

Enzyme Prediction     

No EC number prediction in MGYG000003419_00543.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	303	1.9e-34	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	7.17e-48	3	321	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	7.04e-34	1	298	1	310	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	3.74e-19	72	306	3	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.82e-12	2	266	6	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59711.1	3.46e-104	1	321	1	340
QUT89241.1	4.90e-104	1	321	1	340
ADQ80081.1	6.43e-102	1	323	1	342
QQT78204.1	1.04e-100	1	320	1	339
ASM65268.1	1.04e-100	1	320	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	4.74e-10	12	268	19	292	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	6.13e-09	13	266	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q57336	1.11e-08	3	268	10	286	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003419_00543.