CAZyme Information: MGYG000003419_00547

Basic Information

• Species: RF16 sp900766775
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900766775
• CAZyme ID: MGYG000003419_00547
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		41088.69	9.4637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003419	2335712	MAG	Fiji	Oceania

• Gene Location: Start: 13726; End: 14769 Strand: -

Full Sequence      

MRILIDLSILKNVHCGLGQVALNYGYFFRDKYIPQSDEQIYLLVPSRFVGVFGNKVEYIV
AHKIYRVFPWLIGKRFDVWHAIHQLSRYRPFAKRYILTIHDFNFVYEKRGKKVEQYLKKI
QKKADRADKIVCISEFARQETKRYLQTGKKSIDVIYNGIERIDLQQEHILTQIDPKKPYL
FTIGECKEKKNFHVLLDMMQYLPQYQLYIAGNDHTEYADRMRATIAAKGIQNVRLMGLVS
PEEKVWLYRHCEAFVFPSLFEGFGLPIVEAMLFRKPVICSQETSLIEIGGKHVQFFEKGY
PPKESAELIERTIQNNTEKQEVAFQYATSFSWEHHVQKYLTIYRKDE

Enzyme Prediction     

No EC number prediction in MGYG000003419_00547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	172	321	9.5e-28	0.95625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	1.03e-60	2	340	1	361	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03801	GT4_PimA-like	3.86e-36	69	344	76	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.86e-29	41	345	55	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	1.60e-26	19	278	16	290	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03798	GT4_WlbH-like	1.73e-24	71	345	91	375	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD21346.1	4.29e-94	2	343	11	357
BBD45083.1	2.53e-89	2	343	3	353
ANU59936.1	1.41e-78	2	345	10	356
QQR19251.1	1.41e-78	2	345	10	356
QIK60098.1	1.88e-76	2	344	4	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F9F_A	1.59e-07	179	287	25	134	CrystalStructure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR29A. [Archaeoglobus fulgidus DSM 4304]
4RBN_A	2.83e-06	174	344	556	755	Thecrystal structure of Nitrosomonas europaea sucrose synthase: Insights into the evolutionary origin of sucrose metabolism in prokaryotes [Nitrosomonas europaea],4RBN_B The crystal structure of Nitrosomonas europaea sucrose synthase: Insights into the evolutionary origin of sucrose metabolism in prokaryotes [Nitrosomonas europaea],4RBN_C The crystal structure of Nitrosomonas europaea sucrose synthase: Insights into the evolutionary origin of sucrose metabolism in prokaryotes [Nitrosomonas europaea],4RBN_D The crystal structure of Nitrosomonas europaea sucrose synthase: Insights into the evolutionary origin of sucrose metabolism in prokaryotes [Nitrosomonas europaea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26402	1.31e-09	90	280	102	288	Protein RfbU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbU PE=3 SV=1
Q9HTC0	4.62e-09	167	334	185	332	D-rhamnosyltransferase WbpZ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wbpZ PE=1 SV=1
Q59002	3.57e-07	130	288	152	321	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
O68547	7.64e-07	175	288	164	283	Lipopolysaccharide core biosynthesis mannosyltransferase LpcC OS=Rhizobium leguminosarum bv. viciae OX=387 GN=lpcC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000017	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003419_00547.