CAZyme Information: MGYG000003419_01342

Basic Information

• Species: RF16 sp900766775
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900766775
• CAZyme ID: MGYG000003419_01342
• CAZy Family: PL8
• CAZyme Description: Chondroitin sulfate ABC exolyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
974	MGYG000003419_177|CGC1	110896.15	6.8742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003419	2335712	MAG	Fiji	Oceania

• Gene Location: Start: 25330; End: 28254 Strand: +

Full Sequence      

MKQCLKYIVCLLCCVATCDVAFGEFSQLVPIYRDPAILSFEHSVQPFTTSRGGTISVSGD
HYKHGCHSLLWSWSREGAYLSVRQPIAYEHHKTVNTDNSVYTFVFWMYLEQPLTDSVRFE
FRKQGKVCCWFYYAANFTGWRGAWLAFRRDMQGAPEEGMDELRIYAPKGSRKGRLYLDHV
ILSSLQDVRHHTADFQAPYINPRSESHWLVLLRSWRQEFELPLPDAVSKAQQRDIRRIQQ
RMDKELIGSRLKDTPNLDSLRARYAVYHLEDSPGLPVFFERFGETYTHYDNTTTYTQKIG
DMGLSRANQLLYDLALAYRQQTADSEEIAHMFLSLTRHMLDQGFQAGSAMGTLHHLGYSM
RYFYPAMYLMREVLRDAGMLREVQQAMEWFSGAGEVKVLPRKPGMDIDAFNTSLEGRLLS
ILMIDDPREQVRYLNAFSRWVDNGFRYSDGLSGCFKPDGTIFHHCNHYPAYAVGGLTGAV
KATWLLHGTEWAISRESHEILKQSLLSMRIYCNLTAWPLSLSGRHPDGKGHLIPRHYKQL
AQCGSPDGQHKTDPELQAAYLRLIHKGDTAAERAPEGAWSFPYSCLQVQRRGEWMVAIKG
HSRYIWNTETYERCNLYGRYLNYGNIQIMGSGDPVSNFASGFRQEGWDWNRWPGTTTLIL
PIDSLLCQVRNLDVNSGFEEMLLSDETFCNGLSLGGNGIWGMKLHSHDKYDGTLRARKSV
FCFDNRIICLGTNIACQADAPVETTLFQVAENRTHPNPPYESTPKIEDFSGTPRGRERGP
TPALTDGYGNYYYTADSIRLFEGVQHSRHEETMAPTEGRFRTASIVHGVRPHNGSYEYVI
RVQPTDEEISADLAYEVLRADSAAHIVRDKQTGMTGYVLFEPNAAFGNSAPCLVMTCPTD
SGLVVSVADPDLHLYEGPSDETYDAHGKRVERIIYSYPWKDDPSRPSTITLTIQGQTLTF
TCQHGMASQRTINH

Enzyme Prediction     

No EC number prediction in MGYG000003419_01342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	588	840	6.7e-80	0.9919028340080972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09093	Lyase_catalyt	1.33e-122	221	566	1	357	Lyase, catalytic. Members of this family are predominantly found in chondroitin ABC lyase I, and adopt a helical structure, with fifteen alpha-helices which are at least two turns long and several short helical turns. The bulk of the domain is formed by ten alpha-helices forming five hairpin-like pairs and arranged into an incomplete toroid, the (alpha/alpha)5 fold. Additionally, two long and two short alpha-helices at the N-terminus of the domain wrap around the toroid. At the C-terminal end of the toroid there is one additional short alpha-helix. This domain is required for degradation of polysaccharides containing 1,4-beta-D-hexosaminyl and 1,3-beta-D-glucoronosyl or 1,3-alpha-L-iduronosyl linkages to disaccharides containing 4-deoxy-beta-D-gluc-4-enuronosyl groups.
cd01083	GAG_Lyase	1.49e-108	309	910	68	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam09092	Lyase_N	4.65e-57	37	198	4	166	Lyase, N terminal. Members of this family are predominantly found in chondroitin ABC lyase I, and adopt a jelly-roll fold topology consisting of a two-layered bent beta-sheet sandwich with one short alpha-helix. The convex beta sheet is composed of five antiparallel strands, whilst the concave beta-sheet contains five antiparallel beta-strands with a loop between two consecutive strands folding back onto the concave surface. This domain is required for binding of the protein to long glycosaminoglycan chains.
pfam02278	Lyase_8	2.87e-30	588	840	11	247	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	3.39e-05	858	910	1	59	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63377.1	1.22e-313	26	956	19	971
QZT36747.1	1.84e-240	37	968	37	1026
QUT37264.1	2.14e-237	31	956	26	990
QUT65869.1	2.14e-237	31	956	26	990
QUU01305.1	4.27e-237	31	956	26	990

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Q1F_A	1.27e-213	31	956	16	977	Crystalstructure of chondroitin sulfate lyase abc from bacteroides thetaiotaomicron wal2926 [Bacteroides thetaiotaomicron],2Q1F_B Crystal structure of chondroitin sulfate lyase abc from bacteroides thetaiotaomicron wal2926 [Bacteroides thetaiotaomicron]
1HN0_A	1.47e-87	47	914	53	964	CRYSTALSTRUCTURE OF CHONDROITIN ABC LYASE I FROM PROTEUS VULGARIS AT 1.9 ANGSTROMS RESOLUTION [Proteus vulgaris]
7EIP_A	2.02e-87	47	914	53	964	ChainA, Chondroitin sulfate ABC endolyase [Proteus vulgaris],7EIQ_A Chain A, Chondroitin sulfate ABC endolyase [Proteus vulgaris],7EIR_A Chain A, Chondroitin sulfate ABC endolyase [Proteus vulgaris],7EIS_A Chain A, Chondroitin sulfate ABC endolyase [Proteus vulgaris]
1CB8_A	2.65e-11	608	910	348	639	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	2.71e-11	608	910	370	661	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A2I1	2.17e-225	31	956	16	977	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=chonabc PE=1 SV=1
C5G6D7	4.32e-225	31	956	16	977	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron OX=818 GN=chonabc PE=1 SV=2
C7S340	6.71e-145	48	966	24	963	Chondroitin sulfate ABC exolyase (Fragment) OS=Proteus vulgaris OX=585 GN=ChABCII PE=1 SV=1
P59807	1.11e-86	47	914	53	964	Chondroitin sulfate ABC endolyase OS=Proteus vulgaris OX=585 PE=1 SV=2
Q59288	1.48e-10	608	910	370	661	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000211	0.999198	0.000142	0.000152	0.000135	0.000126

TMHMM  Annotations     

start	end
7	29