CAZyme Information: MGYG000003420_00402

Basic Information

• Species: UBA4372 sp900766785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372; UBA4372 sp900766785
• CAZyme ID: MGYG000003420_00402
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000003420_56|CGC1	44455.67	7.9305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003420	2267758	MAG	Fiji	Oceania

• Gene Location: Start: 1855; End: 3030 Strand: -

Full Sequence      

MKYYLIAGEASGDLHASHLMAELRQQDPQAEFRAVGGDLMQAEGATLVRHYRHLAYMGIL
PVLMHLRTILQGMSECKKDIVRWQPDALILVDYPGFNLSIAKYIHTHTHIPVIYYISPKI
WAWKEHRIKAIRRYVDMMLCILPFEVDFYERKHHYPVHYVGNPTLDEVEAFLAQHPIAES
TFLQDNGLTHQEIIALLPGSRRQEINGNLTRMIQAARPFCSQYQLVIAAAPGIPDEFYHQ
ILDRLQADAVIRDQLHIVRHQTFPLLQHSTAALVTSGTATLETAMLGVRQIVCYYMWAGR
LASLGKKLILKIPYISLVNLVADREVVPELVGEQMNVANVRRHLQALLTDQQVIKAQEEG
YRLMADRLGLPGAPAHAAQLITDRLKDTSKK

Enzyme Prediction     

No EC number prediction in MGYG000003420_00402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	366	7.9e-111	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.81e-107	1	390	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.42e-103	1	386	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.53e-79	4	381	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.20e-67	5	379	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.78e-46	1	339	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ43779.1	1.53e-143	1	386	1	377
QMW86360.1	1.53e-143	1	386	1	377
AAO79109.1	1.53e-143	1	386	1	377
QQA07895.1	4.37e-143	1	386	1	377
AVM56429.1	5.01e-143	1	386	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.55e-31	5	383	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.08e-31	5	383	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	4.74e-55	5	388	11	383	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1D393	9.34e-55	5	385	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	9.57e-55	5	385	11	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	3.62e-54	5	386	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	5.21e-54	5	385	11	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003420_00402.