CAZyme Information: MGYG000003420_01255

Basic Information

• Species: UBA4372 sp900766785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372; UBA4372 sp900766785
• CAZyme ID: MGYG000003420_01255
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1372	MGYG000003420_166|CGC1	151534.21	5.0672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003420	2267758	MAG	Fiji	Oceania

• Gene Location: Start: 5741; End: 9859 Strand: +

Full Sequence      

MKKPLSIIVLLLSIMQGAFALEVSHLKTMAYRNPIGIDVVEPTFSWVLTSEQRGVVQETY
SIRIATDRNFQDIVWQSGTISSQESVDVPAKGFSTSPRTRYYWQVSVTDNKGNTATSAEN
AYFETGLGSEAGWGEAKWIKTGSGAADQNEDGTPITDYEVEVSFEIKSFAAGLIFAASDH
NNYYMWQINTVTGSPRFRPHKWTNGGAACLSEKALAVKVQNNEEHVLRIEVRDAKTATTY
LDGTKVDTRTGDFKFGDFGFREDYDQGNVPEQAYFDNFVVTSGGKTLYKEDFEEADLKMF
TGGSVENGRMLVKGPGTYCWQQKVSDRVHYDVEADMTLINDNASICFSATGSDTYLMWAI
NTFGLSKPVVRRHAYLSGALIYDDTTLPMTNKDVLGKPHHIKISCETPYVRTYIDGTLVD
TYTDTKGILSLGDVGFRVSSTGNEREKAYFDNLKVTVYDSEGGSKTLLSEDFENTTTIFD
EADIKLYNGSKQLYMESAQGTSKRIMQSEGSVMPGAPIMRKEFTTKGQVVKARLYATGLG
VYNVYINGQRVGVTHDDGTTEQDELKPGFTEFHKTVFYTTHDVTTLVQNGENAIGAELTS
GWWSGGIAHGMYGSKPLAFKGKLILTYADGTEESICSDTSWRSSTAGPVRSGDIYNGETY
DARLESQWSSAGYDDSEWQGTAISTDFNGTIRAFEGPIVKAVPALARHPKTITIYEGSTN
DNGSLGSVNVISETSGTSSLSLKAGQTAVIDLAQNAAGWISFKAKGNRGTRIRVRFGEML
NTTGNSSRGDDGPKGSLYTANLRSAAATVKYTLKGDPEGESYHPTTSFFGFRYMEIVATD
DVTLTDVVGETVTSAMDEFSTFQTSHPDVNQLYSNVMWGQRSNFLSVPTDCPQRDERQGW
TADTQVFSMAGMYNADTRTFYEKWMRDMRDAQRTDGAFPHIAPYAWGVGFGAAAWADAGV
ILPWKVYLMTGDKKIIEDNWAAMEKYMDFLATQSDGTYKYNGGGTNYGDWVSYVVTDSRY
CSVCYYAYDAQLMAKMAKVLSSKTGDIYYAKSLKYEKLFENIKTEWQQRYTSASTGLPTI
NTQCAYLMALKYNLLKNETARKRTIQALRSAIVNNGYKLNTGFLGTAILNQTLTEVGLNN
EAYTLLLQRNDPSWLYSIDQGATTIWERWNSYTVANGYGPVSMNSFNHYAYGIVAEWMYR
YMAGIVPDEANAGFRHFILAPNPDRRPTLLYSQKRITSVDAQHWSPVGAIKASWQCDGGD
EMTYVVTVPANTTATLYIPVTEGLSLMESGKDVTEGVEGVQYQGMEDGKAVCLLGSGTYS
FTVGVGTKITSANETELKGAGKVYNLSGMYLGEDINSQPRGIYLQDGKKTAK

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	744	1277	1.9e-157	0.9861111111111112
CBM67	507	682	6.1e-32	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.94e-131	857	1202	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.05e-55	527	703	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.01e-25	747	852	7	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.42e-15	1204	1291	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	0.003	955	1070	97	215	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA09206.1	0.0	23	1323	21	1147
ALJ43908.1	0.0	23	1323	21	1147
ADD61991.1	0.0	23	1323	21	1147
QUT72731.1	0.0	23	1323	21	1147
QUT40529.1	0.0	23	1323	21	1147

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.07e-146	512	1323	298	1030	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.20e-103	520	1279	135	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.32e-101	516	1321	176	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	4.26e-146	512	1323	298	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.24e-134	505	1321	163	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.94e-117	498	1303	153	907	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	9.21e-60	490	1319	161	945	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000386	0.998796	0.000230	0.000193	0.000187	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003420_01255.