CAZyme Information: MGYG000003420_01612

Basic Information

• Species: UBA4372 sp900766785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372; UBA4372 sp900766785
• CAZyme ID: MGYG000003420_01612
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000003420_205|CGC1	39312.71	5.0412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003420	2267758	MAG	Fiji	Oceania

• Gene Location: Start: 23452; End: 24504 Strand: -

Full Sequence      

MKKINTHIFRMKKTTLSVLGAVALLLCAVACGNKTADKHNEPEYECIAYVWKADGQLPPA
DKVTAINYLAAFPNDTHDGISIHNEPRLLQILDLKKINPDLKVLLSMGGAGQEAGWGEMT
ACDSLRAAFVADCKRVVDKYGLDGLDFDWEFPHGDQQDNYVKLFKDVREVLGPDKRVTAA
VGFFGNGFDLREAIKYLDYINLMSYDMGWQAPYHHTSLRRSELSGVCTLEEAIDSCLNKG
LDYKDIVVGLAFYGRGDGTNFKDWTDYRDIVNRDLAAEGMDERWDSVAYVPYIVDSLGTL
IVGYDNPRSLKIKCDYIREKGLKGGMYWRSELDTDSFELTNAVARELLGR

Enzyme Prediction     

No EC number prediction in MGYG000003420_01612.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	60	335	3.6e-57	0.8445945945945946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	6.88e-65	49	335	9	307	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	1.39e-63	59	335	22	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	6.82e-58	59	335	22	334	Glyco_18 domain.
cd02872	GH18_chitolectin_chitotriosidase	2.66e-49	90	347	60	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	5.89e-41	8	349	2	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06865.1	1.41e-182	10	350	5	344
ADV45176.1	1.68e-76	11	348	1	340
QIK61506.1	3.01e-75	22	350	9	348
QIK56154.1	3.01e-75	22	350	9	348
QBQ40121.1	1.42e-74	5	350	2	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GZU_A	1.65e-34	51	350	74	394	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.81e-34	51	350	325	645	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
3QOK_A	2.57e-34	94	347	101	416	ChainA, Putative chitinase II [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
6INX_A	1.87e-33	62	333	26	329	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
4NZC_A	3.35e-32	89	347	75	396	Crystalstructure of Chitinase D from Serratia proteamaculans at 1.45 Angstrom resolution [Serratia proteamaculans 568],4Q22_A Crystal structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine at 1.93 Angstrom resolution [Serratia proteamaculans 568]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q873X9	6.26e-24	72	349	99	406	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1
E9QRF2	6.26e-24	72	349	99	406	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1
P20533	2.28e-23	72	347	129	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P48827	4.47e-22	52	349	75	399	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
E9ERT9	4.51e-22	72	333	94	384	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000018	0.000805	0.999217	0.000005	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003420_01612.