CAZyme Information: MGYG000003423_01790

Basic Information

• Species: W3P20-009 sp900766825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; W3P20-009; W3P20-009; W3P20-009 sp900766825
• CAZyme ID: MGYG000003423_01790
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000003423_74|CGC1	39225.39	6.6903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003423	2824109	MAG	Fiji	Oceania

• Gene Location: Start: 12731; End: 13744 Strand: +

Full Sequence      

MKRLFTLAMATLGLTSSLMAQQPVNPNATPEAKELLKLIYDQQGKGTLCGQHSYPLFSDI
YMERANHQCGAYPVVFGQDFGYSKPGSLDGINFRQRSIDNAIKWHAKGAIITFMWHAVPP
TTDANFTTWQGQNGIQSKLTDQQWKELFTEGSEINLRWKAQVDQVAFFLKQLQDENIPVI
WRPYHEMNGDWFWWGNRPSDYQKLFRMLYDRLTNFHHINNLLWVFNANETGSPNVKPYAD
FYPGKDVVDILATDIYSARYDKENYEALQKVANGKPIAWGECGTLPTPEIIREQPKWVWF
MCWCEWLETKNDQDRRSNLYNAKETITLEEFKAQHSK

Enzyme Prediction     

No EC number prediction in MGYG000003423_01790.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	24	330	1.4e-86	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.70e-44	24	330	1	311	Glycosyl hydrolase family 26.
COG4124	ManB2	1.19e-15	176	264	179	262	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFN75853.1	6.41e-119	23	331	26	332
QFU77331.1	4.04e-110	22	303	24	303
AOS44736.1	8.12e-110	26	303	29	304
AVR44591.1	2.28e-101	11	332	7	325
AOW17007.1	9.28e-99	20	335	6	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	1.40e-92	23	331	23	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HPF_A	4.70e-43	23	330	6	309	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	6.10e-36	25	336	147	452	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	2.11e-35	16	311	38	322	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	6.32e-32	20	303	31	318	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AWB7	2.01e-40	5	331	10	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	1.06e-37	10	328	15	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
G2Q4H7	1.45e-37	25	331	176	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.59e-34	28	331	151	457	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	6.79e-30	24	303	158	429	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000325	0.998905	0.000165	0.000220	0.000182	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003423_01790.