CAZyme Information: MGYG000003424_01883

Basic Information

• Species: SFTJ01 sp004557385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01; SFTJ01 sp004557385
• CAZyme ID: MGYG000003424_01883
• CAZy Family: GH20
• CAZyme Description: N,N'-diacetylchitobiase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832	MGYG000003424_151|CGC2	93106.79	6.2702

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003424	2699357	MAG	Fiji	Oceania

• Gene Location: Start: 36056; End: 38554 Strand: -

Full Sequence      

MKTKRILALAAMALVAVAMWAQQCPVSVRWQMGENSRRSFSAYFTIKNTGSETLGNRWAL
YYNKFSNNIKMAEGQPLDLKPVVNYNYVCLSPNDRYKPLAPGEEITVEVVSGGNFRNISD
KPDGMHFVAEPGGKALAVQVEVAPLEEYKQFSVSGFKNYADGNYAYRQNALSNPESNLDC
DVSEYAVMPMPKQVTLNAKGERVDVPAEVAVVSKSAYLTNAKNYLVRQLQCLGVSDVAKA
KFKITLSIEPAVSENREAYVLEVGKKGISVAGQSAEGVLNGVKTLTSVLEFMNCKQISCA
RVVDYPDFHYRGMMLDISRNFIPYADLLDFIDRLAEYKVNVLQLHFCDDEAWRLEIPGLP
ELTEVGARKGHTLNDYEAGFMMQTYAGSGNPDDGKAPANGYITRSQFVEMLKYAHERGVK
IIPEIETPGHARAAIVAMRYRYKKYIDTDEQKANYYRCFDLDDKGRYESAQGFGDNVLNV
AEPGTYRLLMKVVRELQNMYADAGQRLDIVHLGGDEVAKGCWDNSPKVKQLMKENNYKNE
RDVAEHYFLTITDWLAEQGIKVEGWQEVSTGHSDDYNAKVNPMLAGVNVWSTIGSRDTIA
YSLANRGVPVILSNVGNLYLDMVYRMHEYENGLTWGGCVDEITSFETLPFNIYRSVRTAY
NGEPVDLEKTAKGKPDIKRKDCIVGLQAQLWAETIRNYGMVQEYVFPKIFGLVERAWNAS
PAWGEGSLDEAKYLADRAAYSMRIGRRELPHLSRVGASFHLAQPGAIVDEGMLKVNTAFS
GVDVRYTFDGSEPTEQSPLWSAPVQVPDGVKQIKVKAFYLGKQSVTTRLDVK

Enzyme Prediction     

No EC number prediction in MGYG000003424_01883.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	304	719	4.4e-86	0.9703264094955489

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	3.22e-164	304	740	1	434	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	5.60e-88	308	717	1	342	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.09e-87	308	719	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	7.23e-77	174	799	126	708	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	2.32e-59	308	725	1	324	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12728.1	3.90e-206	2	827	5	829
QUT62496.1	5.20e-200	23	832	29	834
QQA31047.1	5.20e-200	23	832	29	834
BBK89309.1	6.49e-200	23	832	14	819
QUU00208.1	1.47e-199	23	832	29	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	3.67e-80	44	809	44	849	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	5.06e-80	44	809	44	849	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	3.48e-79	44	809	44	849	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZR_A	2.23e-63	187	718	142	609	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	2.66e-62	187	718	139	606	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13670	9.64e-83	45	790	70	846	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
Q04786	6.37e-80	17	790	24	809	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
Q54468	2.25e-79	44	809	71	876	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P49007	1.83e-69	187	718	211	727	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
P96155	7.73e-56	181	712	135	600	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000499	0.998650	0.000249	0.000206	0.000198	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003424_01883.