CAZyme Information: MGYG000003424_01995

Basic Information

• Species: SFTJ01 sp004557385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01; SFTJ01 sp004557385
• CAZyme ID: MGYG000003424_01995
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000003424_171|CGC1	41401.47	7.1491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003424	2699357	MAG	Fiji	Oceania

• Gene Location: Start: 3650; End: 4774 Strand: +

Full Sequence      

MIKLRFYIALALMMTAMAAVAQTTVPDSLLRRYAAAMLMVGFKGDSITPESDAVRYVRDL
HVGGIILFDVDLTGTKQLGSRNITTRQRLRQLTSQLRSYSSEPLLIALDQEGGRVARLKP
QYGYEPTVSHRHLGEVNNRDTTMHYARLMADELAWSGVNMNLAPDIDVNVNAECPVIGQL
GRSFSADTAVVAQNAEWFIDAHHAAGVACAVKHFPGHGSSAADSHYGLTDVTDTWQPGEL
HPFRQLIAHGKLDAVMTAHIFNRQLDAELPSTLSHNMLTRLLRNRLGFNGVILSDDMYMQ
GIVDNYAIEDAIVLAINAGADMLVMGNNITTGYEPERPFKVVQMIVDAVKAGKISPERLR
ESYERIKTLKNRLK

Enzyme Prediction     

No EC number prediction in MGYG000003424_01995.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	325	4.1e-51	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.66e-65	38	374	8	316	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	9.69e-64	29	369	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.12e-61	37	328	3	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.10e-07	82	355	82	338	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM71338.1	2.27e-109	9	372	8	366
AOS85113.1	8.66e-107	7	373	6	368
BAP55532.1	5.84e-105	37	374	71	406
AJF08023.1	5.32e-104	37	373	46	378
ACF12387.1	1.28e-103	9	372	8	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	2.93e-53	37	372	20	339	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	7.50e-49	46	370	69	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.76e-48	46	370	43	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.06e-48	46	370	73	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3TEV_A	3.78e-44	50	323	32	290	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	4.11e-48	46	370	69	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
C4LEY6	3.22e-46	38	328	4	279	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
Q5QUZ5	1.26e-43	36	328	2	279	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
P48823	9.69e-42	38	373	26	383	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P44955	4.71e-39	38	327	4	280	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000701	0.998329	0.000264	0.000235	0.000232	0.000217

TMHMM  Annotations     

start	end
7	29