CAZyme Information: MGYG000003425_03029

Basic Information

• Species: CAG-127 sp900766925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900766925
• CAZyme ID: MGYG000003425_03029
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000003425_389|CGC1	56164.47	5.0314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003425	5056923	MAG	Fiji	Oceania

• Gene Location: Start: 22446; End: 23900 Strand: +

Full Sequence      

MDKLEKSNEYIRSNRVPKEEMPIFHVSPLCGWINDPNGFSIYQNKVHLFYQYHPYSEVWG
PMHWGHCVTEDFIKWEDMPIALAPDQSYDEAGCFSGSGIETKEGHLLVYTGVMEKEHNGV
KKTYQNQCLATGNGVSYKKAEHNPVVIGDMLPDNFSREHFRDPKIWKEADGYYMVVGNKT
EDGIPQVVLFHSDDLREWHYVSVLARDREGKLGVMWECPDFFCLDGKYVLIASPQDMCAD
EEFHNGNNAVYFLGEYDRNNHEFDYQQVYSLDDGLDFYAPQTMLAPDGRRIMIAWMQSWD
SNIRPAGQKWSGMMTLPRELKIENGKLYQSPVRDIEKYYINPVRYDNKEICGKCQLQEVR
GRVLDLTVEILDGDYKEFTIHFAQNEHFNTSLTHFKEKNMLEIDRTYSGMVRDAMAQRRV
KVKNPKENLKFRLILDKYSAEVFVNDGEQVLSITFYTPLEAEGISFECDGIAVTTIQKYI
ISVG

Enzyme Prediction     

No EC number prediction in MGYG000003425_03029.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	25	331	7.8e-99	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1621	SacC	1.07e-136	22	474	30	476	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd08996	GH32_FFase	3.17e-135	31	322	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	2.33e-122	22	457	15	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam00251	Glyco_hydro_32N	1.48e-117	25	331	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	9.49e-116	25	447	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL98710.1	4.59e-264	1	484	1	484
QWT54279.1	2.11e-230	4	479	5	482
BBH27622.1	2.11e-199	1	479	1	474
QUO31536.1	4.27e-199	2	479	3	484
QRT29554.1	1.01e-192	4	483	5	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	3.24e-92	13	460	18	462	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	5.20e-74	9	457	35	461	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	7.84e-73	9	457	35	461	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	5.95e-60	24	469	36	475	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
6NUM_A	4.22e-59	22	456	41	485	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40714	3.60e-87	22	473	26	467	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P16553	2.34e-84	22	475	25	468	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
F8DVG5	1.44e-81	3	448	11	460	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) OX=555217 GN=sacA PE=3 SV=1
P0DJA7	4.01e-81	3	448	11	460	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) OX=264203 GN=sacA PE=1 SV=1
P07819	1.33e-71	24	456	32	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003425_03029.