CAZyme Information: MGYG000003425_04411

Basic Information

• Species: CAG-127 sp900766925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900766925
• CAZyme ID: MGYG000003425_04411
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		94096.44	6.2897

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003425	5056923	MAG	Fiji	Oceania

• Gene Location: Start: 2223; End: 4688 Strand: +

Full Sequence      

MENKFYFDEIRASVIKESQIAIQGLCVADFIDNSKKASAVLIDGEKQLELEVSWYLASIH
AVKKSYSGSRQMTKVVTFTIDLPEEFSNSATMRLYLTENNNKRELYSCSGSKLKKYLGEL
CACVDSVTTDDKNIIVKGWAIDSSDIELSVTNEANGREVSCEVDWFMRTDVLQAFMECKE
SRTVGFIVKLPNSNDRYKLYMRAGSRETVYRVSSAKGASRFTLVNTIYNYTSKTVYSLKN
YGLKATIEKGKRRIKLSMQHDVKSYEKWLKKKAPSAKELSEQRKTIFDYQPTFSILVPLY
ETPERFLVELIDSVKHQTYGNWELCFSDGSRDKEPLQRLISEYSSKDNRIKYIAEKKGPL
GISENTNQAYEIATGDYIVLGDHDDLLRADALFECAKALNVSKSDVIYTDEDKTDAKSKH
FFEPNFKPDFNIDLLRSNNYICHMFVVSKALVEKVGLFDSAFDGAQDYDFILRCVEQANE
VKHIPKAVYHWRTHQASTAATPEAKLYAFEAGKRAIAAHYKRLGLDAEVGNADNLGFYKT
KYKIKGNPLISIVIPNKDHIEDLRKCMDSIDQRSTYRNYEFIIVENNSEKNDTFEWYHEL
EKRDNVHVMYWDKEFNYSAINNYGVNYAHGEYILLLNNDTEIINPDCLEQMLGYCQREDV
GIVGARLYYDDGSIQHAGVIVGYGGIAGHAFVALNEEDGLYQSRTKVACDYSAVTAACLM
TKKSVFEEVGGLEEQFKVAFNDIDFCMKVRATGRLVVYNANAKLYHFESKSRGLEDTPEK
QERFAREIRLFRERWPEILDKGDPYYNVNLTLNKSDFSLRP

Enzyme Prediction     

No EC number prediction in MGYG000003425_04411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	551	693	4.1e-20	0.7764705882352941
GT2	294	455	5.4e-19	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	8.11e-87	291	493	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.65e-38	552	768	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.34e-24	546	792	1	243	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	4.91e-23	304	498	10	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04196	GT_2_like_d	1.65e-18	294	497	1	208	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB25117.1	3.79e-261	1	820	1	813
QEI32629.1	3.79e-261	1	820	1	813
QOV20089.1	5.37e-261	1	820	1	812
QRT31219.1	1.08e-260	1	820	1	813
CBL24563.1	1.83e-256	76	820	69	812

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.01e-136	268	819	344	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.25e-91	265	820	293	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	7.56e-12	290	482	7	200	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
A0A0H2UR96	1.29e-07	294	435	6	144	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
D4GU63	4.22e-06	550	750	20	207	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003425_04411.