CAZyme Information: MGYG000003428_01588

Basic Information

• Species: CAG-180 sp900766945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-180; CAG-180 sp900766945
• CAZyme ID: MGYG000003428_01588
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499	MGYG000003428_298|CGC1	57822.93	4.728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003428	1887881	MAG	Fiji	Oceania

• Gene Location: Start: 956; End: 2455 Strand: +

Full Sequence      

MLHTRASGVLMALSSLPSQYGIGVCGEETKRFILKIKEMGFSYWQVLPLVPPDFYGSPYA
SEAAFAISPLYICPDKLFEQGLVSKETLERNVYYGSPYTADYEFAARCRRELLRAAFQNI
DDTLRAQVRRFQDENRWCGDYALYAAFKAHFGGKPWYEWDEPYRFYETAVEHTEEVEDLY
DYYCFEQYIAHTQWREIKQFANEHGVKILGDMPIYVSFDSADVWSNRELFEIDARTCVRK
RVSGVPPDYFSADGQLWGNPLYDWVEMEKDNYRWWCDRIARARELYDTVRIDHFRAFASY
WAVPAESETAKTGVWEKGPGKKLFDAIFNAFGEVPIVAEDLGTFGEDVVELLQETEFPGM
RVIQFGFSPDCDSTHLPHNYPQNCVAYAGTHDNTTLLAWLWEAIERDRRFALDYCGFDGE
NWGEGGFQSPACRKIIETVFRSSARLAVLSFQDLCGFGSDARMNVPGRAFGNWLFRTTEE
TVSQIDTAYYQKINRLFKR

Enzyme Prediction     

No EC number prediction in MGYG000003428_01588.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	11	495	1.3e-149	0.9838056680161943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	499	1	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	11	476	1	456	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	2.97e-166	5	482	28	505	disproportionating enzyme
COG1640	MalQ	3.55e-130	5	498	14	510	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14510	PRK14510	7.76e-114	2	476	720	1191	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO38582.1	4.85e-172	1	499	1	505
ARD65542.1	4.85e-172	1	499	1	505
QCT73240.1	1.38e-171	1	499	1	505
ALU15685.1	1.82e-157	39	499	1	467
AWW25287.1	1.13e-149	2	499	3	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CPQ_A	3.20e-123	5	481	70	542	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1TZ7_A	5.37e-121	3	480	20	486	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
1X1N_A	3.04e-119	5	481	26	502	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	1.42e-118	5	481	78	554	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
6M6T_A	2.87e-112	1	499	1	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LV91	2.50e-122	5	481	82	554	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1
Q59266	1.34e-119	11	499	1	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
O66937	3.56e-119	5	480	2	466	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P72785	1.87e-118	1	499	1	499	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1
Q06801	7.80e-118	5	481	78	554	4-alpha-glucanotransferase, chloroplastic/amyloplastic OS=Solanum tuberosum OX=4113 GN=DPEP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999531	0.000508	0.000003	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003428_01588.