CAZyme Information: MGYG000003430_00439

Basic Information

• Species: Eubacterium_R sp900766895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900766895
• CAZyme ID: MGYG000003430_00439
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		57787.08	4.7924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003430	1567717	MAG	Fiji	Oceania

• Gene Location: Start: 16131; End: 17654 Strand: -

Full Sequence      

MYKKRGAGVLLHISSMPSPYGVGVLGNDTKHFIDKISDMGFGYWQVLPFNPTDSANSPYC
SESAFAASYIYIDPQGLMDMGLIGQDDVNDNIFDSSPYTAAYEFALEKRLATLKKAFLNI
NDELASSIKKFEINNPWLTDYALYMAVKEQENYKPWWEWSDEHSHYFECVKSIYNYEKSA
AFWKFVQFIFFKQWAEIKSYANKKGVAVIGDMPIYVAMDSVDVWSNLPMFLIDEKTLKVE
KVAGVPPDYFSEDGQLWGNPIYDWKAMKNDGYAWWLSRLEHNLKIFDTVRIDHFRAFASY
WEIPADSKTAKVGEWKKGPGMDLFNKVFEKFGNDAPIIAEDLGVFGEDVVKLLNDTGFPG
MKVIQFGFDPNSDSSHLPHNAGVNSINYVGTHDNNTILGWLWEASEAERAFALDYSHFSG
NNWGDGGYQSASCRAITEAVWQSASSIAVISLQDMCGFGSDARMNIPGVPEKNWRFRTTT
DTIDSIDAEYFRHINSLYRRMYPVFEK

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	11	494	1.7e-145	0.979757085020243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	500	1	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	11	477	1	456	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	2.19e-145	3	501	26	526	disproportionating enzyme
COG1640	MalQ	2.81e-140	3	500	12	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	6.09e-111	1	500	10	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO38582.1	2.63e-176	4	501	4	506
ARD65542.1	3.73e-176	4	501	4	506
QCT73240.1	1.40e-173	4	501	4	506
ALU15685.1	9.17e-160	39	501	1	468
AWW25287.1	4.38e-154	3	500	4	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	2.14e-128	5	500	22	503	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
5CPQ_A	1.17e-119	4	501	69	564	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
6M6T_A	5.93e-117	1	500	1	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
1X1N_A	5.56e-116	4	501	25	524	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	2.56e-115	4	501	77	576	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	1.14e-131	11	500	1	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
O66937	2.20e-128	5	500	2	483	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P0A3Q1	2.34e-127	3	501	2	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	2.34e-127	3	501	2	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P72785	9.49e-124	1	502	1	502	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996695	0.003304	0.000013	0.000006	0.000003	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003430_00439.