CAZyme Information: MGYG000003430_00631

Basic Information

• Species: Eubacterium_R sp900766895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900766895
• CAZyme ID: MGYG000003430_00631
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000003430_58|CGC1	35354.61	4.2838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003430	1567717	MAG	Fiji	Oceania

• Gene Location: Start: 15390; End: 16307 Strand: -

Full Sequence      

MKLSNANATETTKKVYAYICDTYSNGIISGQQESTWVDGSEYEMNYIYNITGKYPAMRGL
DFMNDDFDGVVDRAVDWWNKGGLVTICWHCGADFADDYDDCKNDEIKDWDLVLTDGTPEN
KAFIEAMDKAGKALAELQDAGVTVLWRPFHEFDGQWFWWGKGGEESFKKLWIMMYNHFTN
DLELNNLIWVLGYSHNGTDYKGKPKNWYPGDEYCDIVGADSYEVDENKAEYRLFKIVNKI
TKQGKPLILHECGLIPTVEDLKEVPWCSFMAWHTEWLIDTNSKEHLKEIYNSDYVITLDE
LPNFI

Enzyme Prediction     

No EC number prediction in MGYG000003430_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	4	300	9e-89	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.35e-44	5	300	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	1.76e-16	119	231	156	266	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	1.32e-100	3	303	167	461
BCN30282.1	1.10e-92	2	304	5	299
QQQ74226.1	3.21e-79	5	303	175	467
AEK42302.1	2.80e-78	5	303	154	445
AGT84366.1	2.80e-78	5	303	154	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	5.12e-54	5	301	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	1.07e-51	13	304	44	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6D2X_A	1.12e-45	3	301	4	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
3ZM8_A	2.57e-45	3	304	145	450	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6D2W_A	3.94e-43	3	301	95	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	4.30e-44	3	304	174	479	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	4.98e-43	2	304	145	460	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55297	1.09e-34	3	304	158	464	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	1.47e-34	3	304	156	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55296	3.63e-34	3	304	157	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998597	0.001417	0.000009	0.000002	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003430_00631.