CAZyme Information: MGYG000003430_00853

Basic Information

• Species: Eubacterium_R sp900766895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900766895
• CAZyme ID: MGYG000003430_00853
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
986		112956.49	6.5728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003430	1567717	MAG	Fiji	Oceania

• Gene Location: Start: 4502; End: 7462 Strand: +

Full Sequence      

MKYSVNRAIHSDFNVIDENKLPARAYFIPFSNNDALSKTDYKNERYNSDRVVLLSGEWDF
KYYNKLSYIPSILDTDNTDFDALSVPSTWQRNGYDQIAYINTRYPFPKKPPHIPNDVAVG
IYRKNVELKKYSRQIISFLGVAGALALYINGKYVGYSEGSHNTAEFDITEFVNEGNNEIL
AVNYKWCNGTYLECQDMFRENGIFRDVYIINQEEKHIDDFLFRTSKNADGTYDLKIKIDG
NFDDVDISCDLFTTKESNTIIKNLKVNEWTAETPNLYEVAIKIKDVEVIRTYIGFKDIKI
DGEVFLFNSKPIKMLGVNHHDTHMTKGYAVSLDDLELDVKLMKEYNCNAVRTSHYPPDPA
FLTMCDMYGLYVVDEADIETHGFYAIPHSTYNPNRLSNDIKWASHYLDRVQRMYERDKNH
PSITMWSLGNESGGYKCQDACYDFLKKVNPEIPVHYEGAIRSKRWAYDVVSRMYGTPTLM
RKILKGTAGSKYKGKPFFQCEYAHAMGNGPGGLEEYMELFYSSKQFMGGCIWEWADHSVY
DENARYKWTYGGDHNEPIHDGNFCVDGLFYPDRRPSSGALEMKVCYRPIRAKYNGNSTFE
LRNTRCFKDSSDIEISYEIIVDGISKGNGKIKSIIAPQTIKKIQINSLELNNKDRDVFVN
FTYTDKENGREIATEQAVISLAKINSASVCSSAQIKEEADKITVEFDNGSAVFGKNEGLI
SFNVNDFEYLNQNPLDKQSGFVPHIYRGRLDNDQYMVIFWKIIGLDCSNAKLVSCKVKNK
NGEKYVSTVYDFVTRGLFVLARAEVNYFFEKTGRMRFCVSLKKVCPLTDQLPRFGIHCEL
PKDFENVEYYGRGPVENYSDFKEHSPMGVYKTTVSKMPHKYIKPQDSGNRGDVRYSVVTN
EKGIGFRFSAVENYFSFNANHFTLGQLKAAKHIEDLPDTATTFTAVDGFVRGTGSGSCGP
IPPKEHQIKFGYISPLEYSFEVEPIK

Enzyme Prediction     

No EC number prediction in MGYG000003430_00853.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	34	863	8.5e-173	0.9773936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	19	954	26	998	beta-galactosidase.
PRK10340	ebgA	0.0	13	985	7	1000	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	5.56e-108	54	865	15	804	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.44e-91	298	589	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	6.58e-58	707	980	3	270	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE74712.1	6.77e-225	1	967	1	965
QTE70748.1	9.55e-225	1	967	1	965
QUC68480.1	3.79e-224	1	967	1	965
QUA54413.1	6.50e-221	1	967	1	965
SIP63360.1	1.11e-211	1	967	1	963

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.46e-152	15	982	9	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.50e-152	15	982	10	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	5.81e-138	19	986	16	998	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	2.48e-131	19	970	19	996	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	7.16e-127	19	971	25	1012	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33815	3.77e-156	5	983	2	992	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
P70753	3.07e-153	12	960	9	978	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
Q56307	8.20e-152	15	982	10	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P06864	3.22e-145	18	985	12	1000	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q03WL0	1.49e-135	35	954	29	1001	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999921	0.000089	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003430_00853.