CAZyme Information: MGYG000003431_00582

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; HUN007
• CAZyme ID: MGYG000003431_00582
• CAZy Family: GH124
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		44336.6	4.6284

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003431	2512610	MAG	Fiji	Oceania

• Gene Location: Start: 1680; End: 2870 Strand: -

Full Sequence      

MQSFETIRKEMKIMQKKILKKSVCASLCFGLVISSLSGTTGLFRTASPVSVSANEEMAHD
PSRDVQKDGVGNPFNYGERNTPENGTDEEIRAINHKMTVQEVKYCLYKEIDEHWDLIRVR
FGQNNREMVYALFLGLGTRESTLGGNGDGADIETAHSEGFGVSSAHAYGTMQTAVTAFLD
CNPTFMKEDDVPEMFQYSLTHANFYDAVISNHMGIRKCIHFIRSAIVDYNLEGYQIVRGA
LKAFNTGWANYTGEDDGYYKNYPDEIISLARWYYEEGHLYDNVFTWTNDEKVSKYRQGNV
WEWWGDGVPSLAEISTEPQPPVSETPEPDSTLKGDVNLDGKIDVTDLSVLSLTLADKKEL
SPQAKINADVTGDSNVNLADLATLRQFLSKIITAFP

Enzyme Prediction     

No EC number prediction in MGYG000003431_00582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH124	80	286	3.1e-87	0.5753012048192772

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	3.14e-14	333	388	1	56	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	1.94e-09	334	388	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14253	Dockerin	4.48e-08	334	388	1	55	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
cd14254	Dockerin_II	2.09e-05	334	388	1	53	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
cd14252	Dockerin_like	2.53e-04	334	388	1	56	Dockerin repeat domains and domains resembling dockerin repeats. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU21303.1	1.17e-138	31	396	15	383
SDS74621.1	4.10e-55	78	304	224	431
ABN51673.1	5.44e-46	82	302	145	347
ALX08796.1	2.08e-45	82	302	204	406
ANV76547.1	2.08e-45	82	302	204	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6G1G_A	1.39e-47	82	302	18	220	ChainA, Glycosyl Hydrolase [Acetivibrio thermocellus ATCC 27405],6G1I_A Chain A, Glycosyl Hydrolase [Acetivibrio thermocellus ATCC 27405],6G1I_B Chain B, Glycosyl Hydrolase [Acetivibrio thermocellus ATCC 27405]
2XQO_A	4.02e-45	82	302	38	240	ChainA, Cellulosome Enzyme, Dockerin Type I [Acetivibrio thermocellus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.079796	0.841383	0.076784	0.000914	0.000665	0.000454

TMHMM  Annotations     

start	end
21	43