CAZyme Information: MGYG000003431_01275

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; HUN007
• CAZyme ID: MGYG000003431_01275
• CAZy Family: GT39
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		87513.2	7.5471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003431	2512610	MAG	Fiji	Oceania

• Gene Location: Start: 8199; End: 10529 Strand: -

Full Sequence      

MTSVFIYTILACSIFWIVYSGRIKHGYSGYSFAELIPFWLLMRLCPFMMLKTKAAGNITA
LIVDTVILILIYIITARLKRNPREAAALYMFCPLPAMCIAVGTARTTIINAATAVVAVLL
VILALKKFKIISPSVFLKGYIAACTGSFFIMYALYCQFVSFSDIFKGGKPPVMLIAGLVC
VAAGIVLFFIKAFSGGKTPEKKTESSVQPQKTAHSSETTSGEKFGIKNIIHLAVLTAVYA
AAVVFQLGSHEAPKTGVCFNSDNSELIIDLGEYTTVSKIDFFLGQESLRSISFSAYNEVD
KEWMSIKTEELKTAFAWNSVDIAWSVRYIGLVFGSSDTHVNEIVILDNEGNRITPADTSR
APELFDEQDMHPEYPTYYYRMMFDEIYHGRTAYEFLNDLTIYENTHPPLGKTLISIGIAL
FGMNPFGWRIVCAVLGTAMVPVMYLFAWKLSHRSDTALTGGILMATEFMHFTLSRIATID
IIVAQFILMMFFFMFCFVQEMQQEGKFSKQILWLLLSGISTGLAISTKWTGLYAAAGLAV
IFFTFLLKHCLSEGKKLKESSKYLTKLCIVCVISFIIIPLSFYCLSYIEFVQSYPDKNII
QHAIENAQSMLSYHSGIRDSHPYESPWYSWIIDQKSLLDAITVMDDGKISSLATFGNPLV
FIAGFAAFVYNVYLWKVKEDKPAQFLSIAYLSMLMPWLFIHRTVFIYQYFGCVIIMVMLI
CNSLIQMKRRIKTTETIMVIASVLLFVMFFPEISGITVDREYTDKVLEWLPTWVFE

Enzyme Prediction     

No EC number prediction in MGYG000003431_01275.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	380	589	2.8e-58	0.905829596412556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	9.59e-20	383	587	50	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.86e-17	383	583	23	233	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	2.03e-13	389	636	116	326	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1807	ArnT	7.92e-12	406	545	64	195	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.23e-11	406	578	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30459.1	5.97e-109	228	774	491	1057
BBF42044.1	2.31e-107	201	774	323	919
AIQ72362.1	3.89e-92	223	775	2	592
AVF23614.1	2.08e-89	202	773	448	1052
AQR79911.1	3.80e-89	203	773	446	1049

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	2.03e-06	381	533	89	255	Structureof S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NRZ6	2.80e-16	406	773	99	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
P9WN04	1.15e-15	382	773	72	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.15e-15	382	773	72	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	1.00e-13	382	773	66	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P46971	2.70e-08	381	566	77	280	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	21
28	50
54	76
85	104
108	125
134	156
171	193
426	448
476	498
511	525
529	547
567	589
653	675
682	700
704	726
739	758