CAZyme Information: MGYG000003432_01986

Basic Information

• Species: UBA6857 sp900767015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA6857; UBA6857 sp900767015
• CAZyme ID: MGYG000003432_01986
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		46331.7	5.3346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003432	2333717	MAG	Fiji	Oceania

• Gene Location: Start: 6537; End: 7766 Strand: +

Full Sequence      

MINVGVIGLGQRGMQLIEPMLKMADVRIIAVCDTYKDRVEHAAETVVKAGFPEPFQTEDY
KAVLELKDIDTVVIATSWERHIEIAIESMKKGIFTAMEVGGTYHLEECFDLVQAHEETGT
PFFFLENCCYGQRELMCLNMARKGVFGEIVHCDGAYKHDLRNEVSYGKENRHYRLSHYKE
HNCENYPTHDLGPIAKILGINRGNRMLRLVSVASKACGLHEYIKEHKSDDEELMNTKFQQ
GDIVTTVITCENGETVTLTLDTTLPRIYSRNFTVHGTKGMYQEDGDYVFLEKDITGDVAE
IDMDPQKIWKNTDKYAEKYDNDLWKHKSKGMLESGHGGMDYLVLRSMVNAAKGETLPAID
VYDAAAWMCITALSEKSIQNGNMPVEIPDFTNGKYKNRTDKATGKYALD

Enzyme Prediction     

No EC number prediction in MGYG000003432_01986.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	397	7.7e-144	0.9824561403508771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.97e-17	1	389	3	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.12e-10	2	119	1	113	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41319.1	2.10e-152	2	395	8	397
ALS29040.1	6.44e-151	2	398	5	398
QJD87109.1	1.09e-150	2	395	5	394
QUO31207.1	1.54e-150	2	398	4	398
QNK55026.1	7.19e-149	2	395	5	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.45e-97	2	397	21	433	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.17e-64	2	396	43	439	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
6O15_A	1.13e-06	1	176	1	159	Crystalstructure of a putative oxidoreductase YjhC from Escherichia coli in complex with NAD(H) [Escherichia coli K-12],6O15_B Crystal structure of a putative oxidoreductase YjhC from Escherichia coli in complex with NAD(H) [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	7.94e-97	2	397	21	433	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	8.43e-93	2	398	34	444	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	1.61e-86	2	398	50	460	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	2.40e-86	1	398	52	462	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A0KV43	5.88e-78	1	399	54	452	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain ANA-3) OX=94122 GN=Shewana3_1428 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003432_01986.