CAZyme Information: MGYG000003433_00910

Basic Information

• Species: CAG-485 sp900766975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900766975
• CAZyme ID: MGYG000003433_00910
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000003433_35|CGC1	38860.29	4.4454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003433	2173228	MAG	Fiji	Oceania

• Gene Location: Start: 18501; End: 19556 Strand: -

Full Sequence      

MKMTTIFSGLALAGAMLISSCTEEGPVTNPKQDSPVAPAKETGFARGADVSWVTQMESEG
EKFYTFEGVETECMQLLRDFCGVNSIRLRVWVNPAEGWNSIDDVVVKARRAERLGLRTMI
DFHFSDTWADPGHQQMPAAWEGLSFDELKGAVANHVTEVLTALKGAGVTPEWVQIGNETT
PGMMLPVGSVDNPAQLTALNNSGYDAVKSVFPEAKVIVHLDAGNNQWIYDRMFDILQANG
GKYDMIGMSLYPYWAEEAGEVGGWVKIVDDCIANIAHVKEKYNKPVMICEIGMPYDQEEL
CYQLIKRMMTQPVEGIFYWEPEAPAGYNDGYKMGCFNKGMPTKALSAFTEK

Enzyme Prediction     

No EC number prediction in MGYG000003433_00910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	46	332	2.1e-92	0.9152046783625731

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	3.03e-98	45	348	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	5.72e-81	13	343	5	365	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
cd19608	GH113_mannanase-like	0.004	100	331	61	295	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT70301.1	6.66e-202	1	348	1	350
QMW86976.1	9.46e-202	1	348	1	350
AAO79773.1	9.46e-202	1	348	1	350
QUT42647.1	1.91e-201	1	348	1	350
BCA49296.1	1.91e-201	1	348	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GP5_A	1.43e-197	22	348	21	349	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6GPA_A	4.19e-190	40	348	3	313	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
1HJS_A	6.13e-41	46	321	5	298	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
7OSK_A	1.53e-39	20	299	31	301	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
4BF7_A	5.28e-39	46	321	22	315	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.48e-50	40	321	2	310	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
P83692	3.36e-40	46	321	5	298	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
Q5B153	2.77e-38	46	321	22	315	Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=galA PE=1 SV=2
P48842	1.05e-37	46	321	21	315	Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus OX=5053 GN=gal1 PE=1 SV=1
B0XPR3	2.32e-37	46	321	26	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000064	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003433_00910.