CAZyme Information: MGYG000003435_00393

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; UBA5920
• CAZyme ID: MGYG000003435_00393
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280	MGYG000003435_131|CGC1	31906.37	6.2916

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003435	2203968	MAG	Fiji	Oceania

• Gene Location: Start: 8659; End: 9501 Strand: +

Full Sequence      

MFKVRVAKDGSGDYYTLQEAISSIPYNLEAKITIGEGIYREKIFSDKKNLEIIGEGNVII
TYSDFAKEILSEGKKRGTFRSYTAFFSGEMLRMENITIINSAGSGKDVGQALALYLDVKE
AMLRNVRLYGDQDTLFLSPLPDEEREKNGFFGPRFLLPRERRHTVLEECEIRGGVDFIFG
GGDAYFHNCKIESVDEGYVTAPSGKKEWDGFVFDNCSFTSKKDMIGKVYLMRPWRDEGKV
KFVDCTFGPHINRKMFSPWPGREDKAKLSTFIVENSKFLD

Enzyme Prediction     

No EC number prediction in MGYG000003435_00393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	265	6.1e-63	0.84375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.74e-48	2	259	81	358	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	3.67e-36	4	261	2	247	Pectinesterase.
PLN02773	PLN02773	3.97e-34	4	242	7	232	pectinesterase
PLN02671	PLN02671	1.86e-28	6	271	63	318	pectinesterase
PLN02708	PLN02708	1.67e-27	4	261	243	498	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY12911.1	7.47e-93	1	263	1	264
AXA81880.1	6.94e-83	1	276	1	280
CBK98674.1	3.95e-82	1	276	1	280
QIA44050.1	2.90e-81	1	276	1	280
ATP00222.1	2.90e-81	1	276	1	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	3.64e-19	6	261	7	250	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.85e-16	14	280	18	303	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	2.50e-15	4	261	9	254	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.80e-13	13	280	43	327	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1QJV_A	4.00e-13	14	280	18	303	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	6.59e-29	4	265	7	255	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	1.74e-25	6	268	84	334	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q4PT34	2.91e-21	6	258	48	288	Probable pectinesterase 56 OS=Arabidopsis thaliana OX=3702 GN=PME56 PE=2 SV=1
Q43043	3.12e-20	6	259	61	302	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q9FJ21	4.12e-20	4	261	260	506	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003435_00393.