CAZyme Information: MGYG000003435_00428

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; UBA5920
• CAZyme ID: MGYG000003435_00428
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		42054.67	5.1934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003435	2203968	MAG	Fiji	Oceania

• Gene Location: Start: 1563; End: 2657 Strand: -

Full Sequence      

MWETYFRQYKDTVLPFWLDKQKWNYKDDIIMVGYDDLASATGDNSWRDAIFSSSRFLMLP
DGTVVNLCPESRNIDKISFGKTLTIMRNLTGDPRYVKAVEKVYSMLSDYPRTKEGNFWHK
DIYPNQVWLDGLYMGQPFYAQCVVDYNDDEKWNDIFSQFASAHDLLWDEKRGLYVHANDT
SKESEWCDKESGKSKCIWLRAEGWFLMAMVDTYEIASKHTTLSEKLIPMLKNAVDRLLVY
KDEKTNMFYQLVDEKDMAGNYVETSGSAMIAYALMKGERLGMLEKGYGKIGEEILEGIRR
TYLKSEDGILHLYGICASAGLGPGPDNRRDRDGSPRYYLSEKQGVDNQHGAAACMMAYSE
YVKR

Enzyme Prediction     

No EC number prediction in MGYG000003435_00428.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	19	362	3.5e-86	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.25e-67	1	363	11	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.04e-60	8	364	12	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ99429.1	1.73e-151	1	364	1	365
ANU45824.1	1.73e-151	1	364	1	365
QIX93226.1	3.78e-148	1	364	1	365
AST57062.1	1.54e-94	20	363	19	359
AGB20020.1	2.04e-94	20	363	19	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.27e-76	23	361	23	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	8.44e-52	22	360	38	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.60e-51	22	360	28	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	7.08e-08	23	326	65	350	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.62e-51	22	360	38	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.01e-35	134	360	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.01e-35	134	360	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003435_00428.