CAZyme Information: MGYG000003437_00893

Basic Information

• Species: Eubacterium_R sp900767025
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900767025
• CAZyme ID: MGYG000003437_00893
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656		73290.77	4.3168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003437	2166830	MAG	Fiji	Oceania

• Gene Location: Start: 7938; End: 9908 Strand: +

Full Sequence      

MKNILKAINSKQTAYISFILACLSYLFISSATWAYSWIAELYPLGSNFIPTLKGVIIVCA
VISFIVMIVRSVEKNKSKVFLNIMFLIAFVLSIITFVYGFVLVFSLDSGFTSRGFVNGFS
YMLSNLPYTALAAAFGVLFLISKSKKEIIISVISSLVIAGIVLSSTLIVSNSNMNTTSDL
QEMTFESQNVLVNAEITFESLKKGENPDAENLLADNDKCWTPCDPNRSPEEGYDDSNNSV
VEIKLAQQSEINTALIEEVGNEVQYFRLQALIDGEWKTIYQSEKIQSQRLCSFDAVTTDC
IRLSIDKFRNSDTPAKIKSIKLYNEPARNLESFEVTAYQRLDSDVPTEILAKGDEYVKNY
ARYYDVYSTVIVFAAVHWDENGNIGFGESSEEKFAEEIDALKKIIDNRSNKDHQVKMIVT
ALADGAWGDGHNGVNVYMAKYWQSIADQIIDFTKKYDFDGVDIDWEYPQTADDWKIYDSF
IARLDDGLKADNPDAIISSALSSWNLGMNKDTLDRLDQIQFMAYDGNDEDGYQSSLQQAQ
EGLKAFADNGADISKINIGIAAYGRPVNGSPYWAIWRTLPQANYWDSKYYNVLDGNQIYD
GTFCSPALAGDKTAYAMLSGAGGVMVFRVGCDKTMDDPNSVACGIENAINRYCDNW

Enzyme Prediction     

EC	3.2.1.14	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	364	639	4.3e-29	0.902027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	5.38e-26	369	627	24	302	Glycosyl hydrolases family 18.
smart00636	Glyco_18	4.47e-24	359	632	11	334	Glyco_18 domain.
cd06545	GH18_3CO4_chitinase	1.41e-17	356	564	4	209	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
cd06548	GH18_chitinase	7.70e-17	446	625	114	315	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd00598	GH18_chitinase-like	2.95e-16	369	525	25	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI70669.1	6.69e-14	448	641	111	311
AQT68755.1	3.73e-12	444	652	208	405
QVL33252.1	6.36e-12	459	651	111	289
NP_001034515.1	8.36e-12	369	651	52	381
AAW67570.1	8.36e-12	369	651	52	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WL1_A	1.08e-06	397	565	59	256	Crystalstructure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3G6L_A	1.11e-06	444	637	132	371	Thecrystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
3W4R_A	1.39e-06	397	565	77	274	Crystalstructure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]
3WKZ_A	2.49e-06	397	565	59	256	CrystalStructure of the Ostrinia furnacalis Group I Chitinase catalytic domain E148Q mutant [Ostrinia furnacalis]
1GUV_A	4.04e-06	381	565	42	248	Structureof human chitotriosidase [Homo sapiens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
50	69
82	104
119	141
148	170